GSTT2 Antibody

Images

 
Western Blot: GSTT2 Antibody [H00002953-B01P] - Analysis of GSTT2 expression in transfected 293T cell line by GSTT2 polyclonal antibody. Lane 1: GSTT2 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSTT2 Antibody Summary

Immunogen
GSTT2 (NP_000845.1, 1 a.a. - 244 a.a.) full-length human protein. MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Specificity
Reacts with glutathione S-transferase theta 2.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GSTT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTT2 Antibody

  • EC 2.5.1.18
  • glutathione S-transferase theta 2
  • glutathione S-transferase theta-2
  • Glutathione S-transferase theta-2B
  • GST class-theta-2
  • GSTT2B
  • MGC182032

Background

Glutathione S-transferase (GSTs) theta 2 (GSTT2) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: Alpha, Mu, Pi, Theta, and Zeta. The theta class members GSTT1 and GSTT2 share 55% amino acid sequence identity and both are thought to have an important role in human carcinogenesis. The theta genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002941-D01P
Species: Hu, Mu
Applications: WB
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC

Publications for GSTT2 Antibody (H00002953-B01P) (0)

There are no publications for GSTT2 Antibody (H00002953-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTT2 Antibody (H00002953-B01P) (0)

There are no reviews for GSTT2 Antibody (H00002953-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTT2 Antibody (H00002953-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTT2 Products

Bioinformatics Tool for GSTT2 Antibody (H00002953-B01P)

Discover related pathways, diseases and genes to GSTT2 Antibody (H00002953-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTT2 Antibody (H00002953-B01P)

Discover more about diseases related to GSTT2 Antibody (H00002953-B01P).
 

Pathways for GSTT2 Antibody (H00002953-B01P)

View related products by pathway.

PTMs for GSTT2 Antibody (H00002953-B01P)

Learn more about PTMs related to GSTT2 Antibody (H00002953-B01P).
 

Research Areas for GSTT2 Antibody (H00002953-B01P)

Find related products by research area.

Blogs on GSTT2

There are no specific blogs for GSTT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTT2
Entrez
Uniprot