Home » GSTA4 » GSTA4 Antibodies » GSTA4 Antibody

GSTA4 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in Jurkat.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in human placenta.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody.Lane 1: GSTA4 transfected lysate(25.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GSTA4 Antibody Summary

Immunogen
GSTA4 (NP_001503.1, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Specificity
Reacts with glutathione S-transferase alpha 4.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00002941-D01P in the following application:
Publications
Read Publication using H00002941-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody

  • DKFZp686D21185
  • EC 2.5.1.18
  • glutathione S-alkyltransferase A4
  • glutathione S-aralkyltransferase A4
  • glutathione S-aryltransferase A4
  • glutathione S-transferase A4
  • Glutathione S-transferase A4-4
  • glutathione S-transferase alpha 4
  • glutathione transferase A4-4
  • GST class-alpha member 4
  • GSTA4-4
  • GTA4
  • S-(hydroxyalkyl)glutathione lyase A4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutathione S
Transferase kappa 1 A ...
NBP1-89727
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
GSTA1 Antibody
NBP1-32233
Western Blot: GSTA1 Antibody [NBP1-32233] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE GSTA1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: GSTA1 Antibody [NBP1-32233] - Analysis of methanol-fixed Hep3B, using GSTA1(GTX108012) antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: GSTA1 Antibody [NBP1-32233] - Paraffin-embedded Colon ca, using antibody at 1:250 dilution.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GST Epitope Tag
Antibody
NB600-326
Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the HRP conjugate of NB600-326. Detection of 1.0, 0.3, or 0.1 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.2 ug/ml (1:5,000).
Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).
Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the Biotin conjugate of NB600-326. Detection of 0.1, 0.3, or 1.0 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000). Detection: Streptavidin-HRP (0.1 ug/ml) and chemiluminescence with an exposure time of 60 seconds.
(2 Reviews)
(17 Publications)
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Cytochrome P450
2E1 Antibody
NBP1-85367
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Non-transfected (-) and NRF2-transfected (+, including 3xFlag-tag) 293T whole cell extracts (30ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody diluted by 1:1000.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - NIH/3T3 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NRF2 protein stained by NRF2 antibody [N2C2], Internal diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - Paraffin-embedded Cal27 xenograft, using Nrf2 antibody at 1:500 dilution.
(3 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
GSTA3 Antibody
(1F11)
H00002940-M01
Western Blot: GSTA3 Antibody (1F11) [H00002940-M01] - GSTA3 monoclonal antibody (M01), clone 1F11 Analysis of GSTA3 expression in HepG2.
Immunohistochemistry-Paraffin: GSTA3 Antibody (1F11) [H00002940-M01] - Analysis of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: GSTA3 Antibody (1F11) [H00002940-M01] - Detection limit for recombinant GST tagged GSTA3 is approximately 0.3ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC-P
GSTM2 Antibody
(9E975)
H00002946-M03
Western Blot: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of GSTM2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Cytochrome P450
1A2 Antibody (OTI8F1)
NBP2-02563
Western Blot: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 1A2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 1A2.
Immunohistochemistry-Paraffin: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Cytochrome P450 1A2 mouse monoclonal antibody.
Flow Cytometry: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Cytochrome P450 1A2 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
GSTT2 Antibody
(OTI3B6)
NBP2-03126
Western Blot: GSTT2 Antibody (3B6) [NBP2-03126] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GSTT2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GSTT2.
Immunocytochemistry/Immunofluorescence: GSTT2 Antibody (3B6) [NBP2-03126] Staining of COS7 cells transiently transfected by pCMV6-ENTRY GSTT2.
Immunohistochemistry-Paraffin: GSTT2 Antibody (3B6) [NBP2-03126] - Staining of paraffin-embedded Human tonsil using anti-GSTT2 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GSTM3 Antibody
NBP1-83323
Western Blot: GSTM3 Antibody [NBP1-83323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-256
Immunohistochemistry-Paraffin: GSTM3 Antibody [NBP1-83323] - Staining in human testis and lymph node tissues using anti-GSTM3 antibody. Corresponding GSTM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GSTM3 Antibody [NBP1-83323] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts and Leydig cells.
Species: Hu
Applications: WB, IHC, IHC-P
HspA4 Antibody
(SD0861)
NBP2-67817
Western Blot: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of HSPA4 on Hela cells lysates using anti-HSPA4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of paraffin-embedded rat brain tissue using anti-HSPA4 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GSTA4 Antibody
H00002941-D01P
GSTA4 Antibody
Species: Hu, Mu
Applications: WB

Publications for GSTA4 Antibody (H00002941-D01P)(1)


Review for GSTA4 Antibody (H00002941-D01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002941-D01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTA4 H00002941-D01P
Enlarge
reviewed by:
Zachary Patinkin
 WB Human 02/18/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman Skeletal Muscle Lysate
SpeciesHuman
Lot12096

Blocking

Blocking DetailsProtein Simple Antibody Diluent, 5 min, 25C

Primary Anitbody

Dilution Ratio1:50, 30 min, Protein SImple Antibody Diluent

Secondary Antibody

Secondary DescriptionProtein Simple Anti-Rabbit Secondary
Secondary Manufacturer Cat#042-206
Secondary Concentrationundiluted

Details

Detection NotesWES multi-image analysis

Comments

CommentsSimple Western. Non-specific bands above 40 kDa.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTA4 Antibody (H00002941-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GSTA4 Antibody (H00002941-D01P)

Discover related pathways, diseases and genes to GSTA4 Antibody (H00002941-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA4 Antibody (H00002941-D01P)

Discover more about diseases related to GSTA4 Antibody (H00002941-D01P).
 

Pathways for GSTA4 Antibody (H00002941-D01P)

View related products by pathway.

PTMs for GSTA4 Antibody (H00002941-D01P)

Learn more about PTMs related to GSTA4 Antibody (H00002941-D01P).

Blogs on GSTA4

There are no specific blogs for GSTA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot GSTA4 H00002941-D01P
Enlarge
 Zachary Patinkin
02/18/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol GSTA4
Entrez
Uniprot