GSTA4 Antibody

Images

 
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in Jurkat.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in human placenta.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody.Lane 1: GSTA4 transfected lysate(25.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTA4 Antibody Summary

Immunogen
GSTA4 (NP_001503.1, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Specificity
Reacts with glutathione S-transferase alpha 4.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00002941-D01P in the following application:

Publications
Read Publication using H00002941-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody

  • DKFZp686D21185
  • EC 2.5.1.18
  • glutathione S-alkyltransferase A4
  • glutathione S-aralkyltransferase A4
  • glutathione S-aryltransferase A4
  • glutathione S-transferase A4
  • Glutathione S-transferase A4-4
  • glutathione S-transferase alpha 4
  • glutathione transferase A4-4
  • GST class-alpha member 4
  • GSTA4-4
  • GTA4
  • S-(hydroxyalkyl)glutathione lyase A4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-32233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-86140
Species: Hu
Applications: WB, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-03126
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002941-D01P
Species: Hu, Mu
Applications: WB

Publications for GSTA4 Antibody (H00002941-D01P)(1)

Review for GSTA4 Antibody (H00002941-D01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002941-D01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTA4 H00002941-D01P
Enlarge
reviewed by:
Zachary Patinkin
WB Human 02/18/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman Skeletal Muscle Lysate
SpeciesHuman
Lot12096

Blocking

Blocking DetailsProtein Simple Antibody Diluent, 5 min, 25C

Primary Anitbody

Dilution Ratio1:50, 30 min, Protein SImple Antibody Diluent

Secondary Antibody

Secondary DescriptionProtein Simple Anti-Rabbit Secondary
Secondary Manufacturer Cat#042-206
Secondary Concentrationundiluted

Details

Detection NotesWES multi-image analysis

Comments

CommentsSimple Western. Non-specific bands above 40 kDa.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTA4 Antibody (H00002941-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GSTA4 Antibody (H00002941-D01P)

Discover related pathways, diseases and genes to GSTA4 Antibody (H00002941-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA4 Antibody (H00002941-D01P)

Discover more about diseases related to GSTA4 Antibody (H00002941-D01P).
 

Pathways for GSTA4 Antibody (H00002941-D01P)

View related products by pathway.

PTMs for GSTA4 Antibody (H00002941-D01P)

Learn more about PTMs related to GSTA4 Antibody (H00002941-D01P).

Blogs on GSTA4

There are no specific blogs for GSTA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Zachary Patinkin
02/18/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol GSTA4
Entrez
Uniprot