GSTA4 Antibody - Azide and BSA Free

Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.

Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in Jurkat.

Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in human placenta.

Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody.Lane 1: GSTA4 transfected lysate(25.70 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GSTA4 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GSTA4 (NP_001503.1, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Specificity: Reacts with glutathione S-transferase alpha 4.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTA4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody - Azide and BSA Free

• DKFZp686D21185
• EC 2.5.1.18
• glutathione S-alkyltransferase A4
• glutathione S-aralkyltransferase A4
• glutathione S-aryltransferase A4
• glutathione S-transferase A4
• Glutathione S-transferase A4-4
• glutathione S-transferase alpha 4
• glutathione transferase A4-4
• GST class-alpha member 4
• GSTA4-4
• GTA4
• S-(hydroxyalkyl)glutathione lyase A4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GSTA4 Antibody (H00002941-D01P)(2)

Publications using H00002941-D01P

• Kaisar MA, Sivandzade F, Bhalerao A, Cucullo L Conventional and electronic cigarettes dysregulate the expression of iron transporters and detoxifying enzymes at the brain vascular endothelium: In vivo evidence of a gender-specific cellular response to chronic cigarette smoke exposure Neurosci Lett. 2018-08-23 [PMID: 29879439]
• Yang Y, Huycke MM, Herman TS, Wang X. Glutathione S-transferase alpha 4 induction by activator protein 1 in colorectal cancer. Oncogene 2016-04-11 [PMID: 27065323]

Review for GSTA4 Antibody (H00002941-D01P) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Zachary Patinkin WB Human 02/18/2015

Summary

• Application: Western Blot
• Sample Tested: Human Skeletal Muscle Lysate
• Species: Human
• Lot: 12096

Bioinformatics

• Gene Symbol: GSTA4
• Entrez:
  • 2941(Human)
• Uniprot:
  • NP_001503.1(Human)