Home » GSTA4 » GSTA4 Antibodies » GSTA4 Antibody

GSTA4 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in mouse spleen.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in Jurkat.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in human placenta.
Western Blot: GSTA4 Antibody [H00002941-D01P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody.Lane 1: GSTA4 transfected lysate(25.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GSTA4 Antibody Summary

Immunogen
GSTA4 (NP_001503.1, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Specificity
Reacts with glutathione S-transferase alpha 4.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00002941-D01P in the following applications:
Publications
Read Publication using H00002941-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody

  • DKFZp686D21185
  • EC 2.5.1.18
  • glutathione S-alkyltransferase A4
  • glutathione S-aralkyltransferase A4
  • glutathione S-aryltransferase A4
  • glutathione S-transferase A4
  • Glutathione S-transferase A4-4
  • glutathione S-transferase alpha 4
  • glutathione transferase A4-4
  • GST class-alpha member 4
  • GSTA4-4
  • GTA4
  • S-(hydroxyalkyl)glutathione lyase A4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
GSTA1 Antibody
NBP1-32233
Western Blot: GSTA1 Antibody [NBP1-32233] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE GSTA1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: GSTA1 Antibody [NBP1-32233] - Analysis of methanol-fixed Hep3B, using GSTA1(GTX108012) antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: GSTA1 Antibody [NBP1-32233] - Paraffin-embedded Colon ca, using antibody at 1:250 dilution.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GST Epitope Tag
Antibody
NB600-326
Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).
Simple Western: GST Epitope Tag Antibody [NB600-326] - Simple Western lane view shows a specific band for GST Epitope Tag in 5 ng/ml of hUbiquitn-GST (left) & hISG15-GST (right) lysate(s). This experiment was performed under reducing conditions using the 12 - 230 kDa separation system.
Simple Western: GST Epitope Tag Antibody [NB600-326] - Electropherogram image(s) of corresponding Simple Western lane view. GST Epitope Tag antibody was used at 1:2000 dilution on hUbiquitn-GST (left) & hISG15-GST (right) lysate(s).
(2 Reviews)
(16 Publications)
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Cytochrome P450
2E1 Antibody
NBP1-85367
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium shows no positivity in glandular or stromal cells as expected.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.
(1 Publication)
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Hydralazine enhances NRF2 signaling in SH-SY5Y cells. c Hydralazine reduced the interaction between NRF2 and KEAP1. Interactions were measured by reciprocal Co-IPs followed by western blot analysis. *p < 0.05, two-tailed Student's t test, n = 3, mean +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-017-02394-3), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - NRF2 antibody [N2C2], Internal detects NRF2 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: NRF2 stained by NRF2 antibody [N2C2], Internal (NBP1-32822) diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:100.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - NRF2 antibody [N2C2], Internal detects NRF2 protein at cytoplasm and nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human breast carcinoma.NRF2 stained by NRF2 antibody [N2C2], Internal (NBP1-32822) diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(4 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
GSTA3 Antibody
(1F11)
H00002940-M01
Western Blot: GSTA3 Antibody (1F11) [H00002940-M01] - GSTA3 monoclonal antibody (M01), clone 1F11 Analysis of GSTA3 expression in HepG2.
Immunohistochemistry-Paraffin: GSTA3 Antibody (1F11) [H00002940-M01] - Analysis of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: GSTA3 Antibody (1F11) [H00002940-M01] - Detection limit for recombinant GST tagged GSTA3 is approximately 0.3ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
GSTM2 Antibody
(1E10)
H00002946-M03
Western Blot: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of GSTM2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Cytochrome P450
1A2 Antibody (OTI8F1)
NBP2-02563
Western Blot: Cytochrome P450 1A2 Antibody (OTI8F1) [NBP2-02563] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 1A2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 1A2.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A2 Antibody (OTI8F1) [NBP2-02563] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY CYP1A2.
Immunohistochemistry-Paraffin: Cytochrome P450 1A2 Antibody (OTI8F1) [NBP2-02563] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Cytochrome P450 1A2 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
(3 Reviews)
(8 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
GSTT2 Antibody
(OTI3B6)
NBP2-03126
Western Blot: GSTT2 Antibody (3B6) [NBP2-03126] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GSTT2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GSTT2.
Immunocytochemistry/Immunofluorescence: GSTT2 Antibody (3B6) [NBP2-03126] Staining of COS7 cells transiently transfected by pCMV6-ENTRY GSTT2.
Immunohistochemistry-Paraffin: GSTT2 Antibody (3B6) [NBP2-03126] - Staining of paraffin-embedded Human tonsil using anti-GSTT2 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GSTM3 Antibody
NBP1-83323
Western Blot: GSTM3 Antibody [NBP1-83323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-256
Immunohistochemistry-Paraffin: GSTM3 Antibody [NBP1-83323] - Staining in human testis and lymph node tissues using anti-GSTM3 antibody. Corresponding GSTM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GSTM3 Antibody [NBP1-83323] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts and Leydig cells.
Species: Hu
Applications: WB, IHC, IHC-P
HspA4 Antibody
(SD0861)
NBP2-67817
Western Blot: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of HSPA4 on Hela cells lysates using anti-HSPA4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of paraffin-embedded rat brain tissue using anti-HSPA4 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GSTA4 Antibody
H00002941-D01P
GSTA4 Antibody
Species: Hu, Mu
Applications: WB, IHC

Publications for GSTA4 Antibody (H00002941-D01P)(1)


Review for GSTA4 Antibody (H00002941-D01P) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00002941-D01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GSTA4 H00002941-D01P
Enlarge 		3
reviewed by:
Zachary Patinkin
 WB Human 02/18/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman Skeletal Muscle Lysate
SpeciesHuman
Lot12096

Blocking

Blocking DetailsProtein Simple Antibody Diluent, 5 min, 25C

Primary Anitbody

Dilution Ratio1:50, 30 min, Protein SImple Antibody Diluent

Secondary Antibody

Secondary DescriptionProtein Simple Anti-Rabbit Secondary
Secondary Manufacturer Cat#042-206
Secondary Concentrationundiluted

Details

Detection NotesWES multi-image analysis

Comments

CommentsSimple Western. Non-specific bands above 40 kDa.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTA4 Antibody (H00002941-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GSTA4 Products

Bioinformatics Tool for GSTA4 Antibody (H00002941-D01P)

Discover related pathways, diseases and genes to GSTA4 Antibody (H00002941-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA4 Antibody (H00002941-D01P)

Discover more about diseases related to GSTA4 Antibody (H00002941-D01P).
 

Pathways for GSTA4 Antibody (H00002941-D01P)

View related products by pathway.

PTMs for GSTA4 Antibody (H00002941-D01P)

Learn more about PTMs related to GSTA4 Antibody (H00002941-D01P).

Blogs on GSTA4

There are no specific blogs for GSTA4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot GSTA4 H00002941-D01P
Enlarge
 Zachary Patinkin
02/18/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol GSTA4
Entrez
Uniprot