GSTA4 Antibody - Azide and BSA Free

Western Blot: GSTA4 Antibody [H00002941-B01P] - Analysis of GSTA4 expression in IMR-32.

Western Blot: GSTA4 Antibody [H00002941-B01P] - Analysis of GSTA4 expression in transfected 293T cell line by GSTA4 polyclonal antibody. Lane 1: GSTA4 transfected lysate(24.53 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GSTA4 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GSTA4 (AAH15523, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
• Specificity: GSTA4 - glutathione S-transferase A4,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GSTA4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA4 Antibody - Azide and BSA Free

• DKFZp686D21185
• EC 2.5.1.18
• glutathione S-alkyltransferase A4
• glutathione S-aralkyltransferase A4
• glutathione S-aryltransferase A4
• glutathione S-transferase A4
• Glutathione S-transferase A4-4
• glutathione S-transferase alpha 4
• glutathione transferase A4-4
• GST class-alpha member 4
• GSTA4-4
• GTA4
• S-(hydroxyalkyl)glutathione lyase A4

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GSTA4 Antibody (H00002941-B01P)(1)

Publication using H00002941-B01P

• Yang Y, Huycke MM, Herman TS, Wang X. Glutathione S-transferase alpha 4 induction by activator protein 1 in colorectal cancer. Oncogene 2016-04-11 [PMID: 27065323]

Bioinformatics

• Gene Symbol: GSTA4
• Entrez:
  • 2941(Human)
• Uniprot:
  • AAH15523(Human)