GSTA1 Antibody

Images

 
Western Blot: GSTA1 Antibody [NBP2-46817] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Analysis of ...read more
Immunocytochemistry/ Immunofluorescence: GSTA1 Antibody [NBP2-46817] - Staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry: GSTA1 Antibody [NBP2-46817] - Staining of human Analysis of human liver tissue. shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GSTA1 Recombinant Protein Antigen (NBP2-46817PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTA1 Antibody

  • EC 1.11.1.-
  • EC 2.5.1.18
  • EC 5.3.3.-
  • glutathione S-alkyltransferase A1
  • glutathione S-aryltransferase A1
  • glutathione S-transferase 2
  • glutathione S-transferase A1
  • glutathione S-transferase alpha 1
  • glutathione S-transferase Ha subunit 1
  • GST class-alpha member 1
  • GST HA subunit 1
  • GST, class alpha, 1
  • GST2
  • GSTA1
  • GSTA1-1
  • GST-epsilon
  • GTH1
  • MGC131939
  • S-(hydroxyalkyl)glutathione lyase A1

Background

GSTA1 is glutathione S-transferase which are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002946-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-32157
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00002551-M03
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB

Publications for GSTA1 Antibody (NBP2-46817) (0)

There are no publications for GSTA1 Antibody (NBP2-46817).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA1 Antibody (NBP2-46817) (0)

There are no reviews for GSTA1 Antibody (NBP2-46817). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTA1 Antibody (NBP2-46817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTA1 Products

Bioinformatics Tool for GSTA1 Antibody (NBP2-46817)

Discover related pathways, diseases and genes to GSTA1 Antibody (NBP2-46817). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA1 Antibody (NBP2-46817)

Discover more about diseases related to GSTA1 Antibody (NBP2-46817).
 

Pathways for GSTA1 Antibody (NBP2-46817)

View related products by pathway.

PTMs for GSTA1 Antibody (NBP2-46817)

Learn more about PTMs related to GSTA1 Antibody (NBP2-46817).
 

Research Areas for GSTA1 Antibody (NBP2-46817)

Find related products by research area.

Blogs on GSTA1

There are no specific blogs for GSTA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA1
Entrez
Uniprot