GRP78/HSPA5 Recombinant Protein Antigen

Images

 
There are currently no images for GRP78/HSPA5 Protein (NBP1-89969PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRP78/HSPA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPA5.

Source: E.coli

Amino Acid Sequence: EKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89969.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRP78/HSPA5 Recombinant Protein Antigen

  • 78 kDa glucose-regulated protein
  • BIP
  • Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78
  • FLJ26106
  • GRP78
  • GRP-78
  • GRP78BIP
  • Heat shock 70 kDa protein 5
  • heat shock 70kD protein 5 (glucose-regulated protein, 78kD)
  • heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
  • HSP70-5
  • HSPA5
  • Immunoglobulin heavy chain-binding protein
  • MIF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-89969PEP
Species: Hu
Applications: AC

Publications for GRP78/HSPA5 Protein (NBP1-89969PEP) (0)

There are no publications for GRP78/HSPA5 Protein (NBP1-89969PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRP78/HSPA5 Protein (NBP1-89969PEP) (0)

There are no reviews for GRP78/HSPA5 Protein (NBP1-89969PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GRP78/HSPA5 Protein (NBP1-89969PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRP78/HSPA5 Products

Bioinformatics Tool for GRP78/HSPA5 Protein (NBP1-89969PEP)

Discover related pathways, diseases and genes to GRP78/HSPA5 Protein (NBP1-89969PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRP78/HSPA5 Protein (NBP1-89969PEP)

Discover more about diseases related to GRP78/HSPA5 Protein (NBP1-89969PEP).
 

Pathways for GRP78/HSPA5 Protein (NBP1-89969PEP)

View related products by pathway.

PTMs for GRP78/HSPA5 Protein (NBP1-89969PEP)

Learn more about PTMs related to GRP78/HSPA5 Protein (NBP1-89969PEP).
 

Research Areas for GRP78/HSPA5 Protein (NBP1-89969PEP)

Find related products by research area.

Blogs on GRP78/HSPA5.

GRP78 - molecular chaperone and negative regulator of the unfolded protein response
The 78 kDa glucose-regulated protein (GRP78) is the eukaryotic orthologue to the prokaryotic heat shock 70 kDa protein 5 (HSPA5). GRP78 is also sometimes referred to as BiP. GRP78 is a member of the HSP70 family and plays dynamic roles in protein...  Read full blog post.

Customers Who Bought This Also Bought

ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRP78/HSPA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA5
Entrez