GRINL1A Antibody

Images

 
Western Blot: GRINL1A Antibody [NBP2-85017] - WB Suggested Anti-GRINL1A Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRINL1A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of GRINL1A. Peptide sequence: QHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
POLR2M
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRINL1A Antibody

  • DKFZp586F1918
  • glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A
  • Glutamate receptor-like protein 1A
  • GRINL1A downstream protein Gdown4
  • protein GRINL1A
  • protein GRINL1A, isoforms 4/5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45634
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-45856
Species: Ca, Hu, Mu
Applications: ICC/IF, IF, IHC, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81759
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-83438
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00055197-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-56292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85017
Species: Hu
Applications: WB

Publications for GRINL1A Antibody (NBP2-85017) (0)

There are no publications for GRINL1A Antibody (NBP2-85017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRINL1A Antibody (NBP2-85017) (0)

There are no reviews for GRINL1A Antibody (NBP2-85017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRINL1A Antibody (NBP2-85017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRINL1A Products

Bioinformatics Tool for GRINL1A Antibody (NBP2-85017)

Discover related pathways, diseases and genes to GRINL1A Antibody (NBP2-85017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRINL1A Antibody (NBP2-85017)

Discover more about diseases related to GRINL1A Antibody (NBP2-85017).
 

Pathways for GRINL1A Antibody (NBP2-85017)

View related products by pathway.

PTMs for GRINL1A Antibody (NBP2-85017)

Learn more about PTMs related to GRINL1A Antibody (NBP2-85017).

Blogs on GRINL1A

There are no specific blogs for GRINL1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRINL1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2M