Recombinant Human GRID2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GRID2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GRID2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRID2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRID2 Protein

  • B230104L07Rik
  • cpr
  • creeper
  • gluR delta-2 subunit
  • GLURD2
  • GluRdelta2
  • glutamate receptor delta-2 subunit
  • glutamate receptor, ionotropic, delta 2
  • GRID2
  • ho
  • hotfoot
  • Lc
  • lurcher
  • minisatellite 10ac detected by probe MMS10
  • MMS10-AC
  • Ms10ac
  • nmf408
  • SCAR18
  • tpr

Background

GRID2 - glutamate receptor, ionotropic, delta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77238
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16095
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002895-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GRID2 Partial Recombinant Protein (H00002895-Q01) (0)

There are no publications for GRID2 Partial Recombinant Protein (H00002895-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRID2 Partial Recombinant Protein (H00002895-Q01) (0)

There are no reviews for GRID2 Partial Recombinant Protein (H00002895-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRID2 Partial Recombinant Protein (H00002895-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRID2 Products

Bioinformatics Tool for GRID2 Partial Recombinant Protein (H00002895-Q01)

Discover related pathways, diseases and genes to GRID2 Partial Recombinant Protein (H00002895-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRID2 Partial Recombinant Protein (H00002895-Q01)

Discover more about diseases related to GRID2 Partial Recombinant Protein (H00002895-Q01).
 

Pathways for GRID2 Partial Recombinant Protein (H00002895-Q01)

View related products by pathway.

PTMs for GRID2 Partial Recombinant Protein (H00002895-Q01)

Learn more about PTMs related to GRID2 Partial Recombinant Protein (H00002895-Q01).
 

Research Areas for GRID2 Partial Recombinant Protein (H00002895-Q01)

Find related products by research area.

Blogs on GRID2

There are no specific blogs for GRID2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GRID2 Antibody
NBP1-46489

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRID2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRID2
Entrez