GRHL3 Antibody

Images

 
Western Blot: GRHL3 Antibody [NBP1-80355] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP1-80355] - Human placenta tissue at an antibody concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHL3 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GRHL3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRHL3 Antibody

  • grainyhead-like 3 (Drosophila)
  • MGC46624
  • Sister of mammalian grainyhead
  • sister-of-mammalian grainyhead
  • SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
  • TFCP2L4
  • transcription factor hSOM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for GRHL3 Antibody (NBP1-80355) (0)

There are no publications for GRHL3 Antibody (NBP1-80355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL3 Antibody (NBP1-80355) (0)

There are no reviews for GRHL3 Antibody (NBP1-80355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRHL3 Antibody (NBP1-80355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GRHL3 Antibody (NBP1-80355)

Discover related pathways, diseases and genes to GRHL3 Antibody (NBP1-80355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL3 Antibody (NBP1-80355)

Discover more about diseases related to GRHL3 Antibody (NBP1-80355).
 

Pathways for GRHL3 Antibody (NBP1-80355)

View related products by pathway.

PTMs for GRHL3 Antibody (NBP1-80355)

Learn more about PTMs related to GRHL3 Antibody (NBP1-80355).

Blogs on GRHL3

There are no specific blogs for GRHL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL3
Uniprot