GRHL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GRHL2 Antibody [NBP2-56852] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV
Specificity
Specificity of human GRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRHL2 Recombinant Protein Antigen (NBP2-56852PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRHL2 Antibody

  • BOMMGC149294
  • Brother of mammalian grainyhead
  • deafness, autosomal dominant 28
  • DFNA28
  • FLJ13782
  • grainyhead-like 2 (Drosophila)
  • grainyhead-like protein 2 homolog
  • TFCP2L3MGC149295
  • Transcription factor CP2-like 3FLJ11172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-80355
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-81321
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
H00001392-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-47214
Species: Hu, Mu, Rt, Ca
Applications: IHC, IHC-P, PEP-ELISA
NBP2-56852
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for GRHL2 Antibody (NBP2-56852) (0)

There are no publications for GRHL2 Antibody (NBP2-56852).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL2 Antibody (NBP2-56852) (0)

There are no reviews for GRHL2 Antibody (NBP2-56852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRHL2 Antibody (NBP2-56852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRHL2 Products

Bioinformatics Tool for GRHL2 Antibody (NBP2-56852)

Discover related pathways, diseases and genes to GRHL2 Antibody (NBP2-56852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL2 Antibody (NBP2-56852)

Discover more about diseases related to GRHL2 Antibody (NBP2-56852).
 

Pathways for GRHL2 Antibody (NBP2-56852)

View related products by pathway.

PTMs for GRHL2 Antibody (NBP2-56852)

Learn more about PTMs related to GRHL2 Antibody (NBP2-56852).

Blogs on GRHL2

There are no specific blogs for GRHL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL2