GRHL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining in human skin and skeletal muscle tissues using NBP1-81321 antibody. Corresponding GRHL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-GRHL1 antibody NBP1-81321 (A) shows similar protein distribution across tissues to independent antibody NBP1-81322 (B).

Western Blot: GRHL1 Antibody [NBP1-81321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: GRHL1 Antibody [NBP1-81321] - Staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.

Western Blot: GRHL1 Antibody [NBP1-81321] - Analysis in human cell line BEWO.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRHL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRHL1 Antibody - BSA Free (NBP1-81321) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and ChIP. Anti-GRHL1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRHL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID:31932695)
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRHL1 Protein (NBP1-81321PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GRHL1 Antibody - BSA Free

• grainyhead-like 1 (Drosophila)
• grainyhead-like protein 1 homolog
• LBP protein 32
• MGRLBP-32
• NH32
• TFCP2L2
• Transcription factor CP2-like 2LBP32Mammalian grainyhead
• Transcription factor LBP-32

Background

GRHL1 encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRHL1 Antibody (NBP1-81321)(5)

Publications using NBP1-81321

• Lu Z, Fan L, Zhang F et al. HSPA12A was identified as a key driver in colorectal cancer GWAS loci 10q26.12 and modulated by an enhancer-promoter interaction Archives of toxicology 2023-05-28 [PMID: 37245169] (ChIP)
• Michelson DA, Hase K, Kaisho T et al. Thymic epithelial cells co-opt lineage-defining transcription factors to eliminate autoreactive T cells Cell 2022-06-12 [PMID: 35714609]
• Xu G, Chhangawala S, Cocco E et al. ARID1A determines luminal identity and therapeutic response in estrogen-receptor-positive breast cancer Nat. Genet. 2020-01-13 [PMID: 31932695] (Chemotaxis, Human)
• Li Mengyan, Li Zhuo, Guan Xinyuan, Qin Yanru Suppressor gene GRHL1 is associated with prognosis in patients with oesophageal squamous cell carcinoma. Oncology Letters 2019-02-25 [PMID: 30944626] (WB, IF/IHC, Human)
• Tran QT, Kennedy LH, Leon Carrion S et al. EGFR regulation of epidermal barrier function. Physiol Genomics 2012-04-15 [PMID: 22395315]

Bioinformatics

• Gene Symbol: GRHL1