GRHL2 Antibody

Images

 
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Use in Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:24375798).For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRHL2 Protein (NBP1-88552PEP)
Publications
Read Publications using
NBP1-88552 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%), Mouse (87%) Use in Mouse reported in scientific literature (PMID:24375798).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRHL2 Antibody

  • BOMMGC149294
  • Brother of mammalian grainyhead
  • deafness, autosomal dominant 28
  • DFNA28
  • FLJ13782
  • grainyhead-like 2 (Drosophila)
  • grainyhead-like protein 2 homolog
  • TFCP2L3MGC149295
  • Transcription factor CP2-like 3FLJ11172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY7847-05
Species: Hu
Applications: ELISA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4077
Species: Hu
Applications: IHC, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-57087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-81321
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr
AF1235
Species: Hu
Applications: IHC, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-47214
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88552
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for GRHL2 Antibody (NBP1-88552)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IHC
(3)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(3)
Mouse
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-88552 Applications Species
Quan Y, Xu M et al. Grainyhead-like 2 Promotes Tumor Growth and is Associated with Poor Prognosis in Colorectal Cancer. J Cancer Mar 15 2015 [PMID: 25767604] (IHC, WB, Human) IHC, WB Human
Torres-Reyes LA, Alvarado-Ruiz L, Pina-Sanchez P et al. Expression of transcription factor grainyhead-like 2 is diminished in cervical cancer. Int J Clin Exp Pathol 2014 [PMID: 25550776] (IHC, Human) IHC Human
Butz H, Szabo PM, Nofech-Mozes R et al. Integrative Bioinformatics Analysis Reveals New Prognostic Biomarkers of Clear Cell Renal Cell Carcinoma. Clin Chem. 2014 Aug 19 [PMID: 25139457] (IHC-P) IHC-P
Quan Y, Jin R, Huang A et al. Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1. Cancer Biol Ther 2014 Jul [PMID: 24756066] (IHC, Human) IHC Human
Varma S, Mahavadi P et al. Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis. Am J Physiol Lung Cell Mol Physiol Jan 3 2014 [PMID: 24375798] (ICC/IF, Mouse) ICC/IF Mouse
Gao X, Vockley CM, Pauli F et al. Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium. Proc Natl Acad Sci U S A 2013 Jun 4 [PMID: 23690579]
Varma S, Cao Y, Tagne JB et al. The Transcription Factors Grainyhead-like 2 and NK2-Homeobox 1 Form a Regulatory Loop That Coordinates Lung Epithelial Cell Morphogenesis and Differentiation. J Biol Chem 2012 Oct 26 [PMID: 22955271]

Reviews for GRHL2 Antibody (NBP1-88552) (0)

There are no reviews for GRHL2 Antibody (NBP1-88552). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRHL2 Antibody (NBP1-88552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRHL2 Products

Bioinformatics Tool for GRHL2 Antibody (NBP1-88552)

Discover related pathways, diseases and genes to GRHL2 Antibody (NBP1-88552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL2 Antibody (NBP1-88552)

Discover more about diseases related to GRHL2 Antibody (NBP1-88552).
 

Pathways for GRHL2 Antibody (NBP1-88552)

View related products by pathway.

PTMs for GRHL2 Antibody (NBP1-88552)

Learn more about PTMs related to GRHL2 Antibody (NBP1-88552).

Blogs on GRHL2

There are no specific blogs for GRHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL2