GRHL2 Antibody

Images

 
Western Blot: GRHL2 Antibody [NBP1-88552] - Analysis in control (vector only transfected HEK293T lysate) and gRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: GRHL2 Antibody [NBP1-88552] - Staining of human cell line RT4 shows positivity in plasma membrane and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: GRHL2 Antibody [NBP1-88552] - Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRHL2 Protein (NBP1-88552PEP)
Publications
Read Publications using
NBP1-88552 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 22955271)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRHL2 Antibody

  • BOMMGC149294
  • Brother of mammalian grainyhead
  • deafness, autosomal dominant 28
  • DFNA28
  • FLJ13782
  • grainyhead-like 2 (Drosophila)
  • grainyhead-like protein 2 homolog
  • TFCP2L3MGC149295
  • Transcription factor CP2-like 3FLJ11172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-80356
Species: Hu
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-81321
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-46288
Species: Hu
Applications: IHC
NBP1-88552
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GRHL2 Antibody (NBP1-88552)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 5 applications: ChIP, ICC/IF, IHC, IHC-P, WB.


Filter By Application
ChIP
(1)
ICC/IF
(1)
IHC
(3)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(3)
Mouse
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-88552 Applications Species
Quan Y, Xu M, Cui P et al. Grainyhead-like 2 Promotes Tumor Growth and is Associated with Poor Prognosis in Colorectal Cancer. J Cancer 2015 [PMID: 25767604] (IHC, WB, Human) IHC, WB Human
Torres-Reyes LA, Alvarado-Ruiz L, Pina-Sanchez P et al. Expression of transcription factor grainyhead-like 2 is diminished in cervical cancer. Int J Clin Exp Pathol 2014 [PMID: 25550776] (IHC, Human) IHC Human
Butz H, Szabo PM, Nofech-Mozes R et al. Integrative Bioinformatics Analysis Reveals New Prognostic Biomarkers of Clear Cell Renal Cell Carcinoma. Clin Chem. 2014 Aug 19 [PMID: 25139457] (IHC-P) IHC-P
Quan Y, Jin R, Huang A et al. Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1. Cancer Biol Ther 2014 Jul [PMID: 24756066] (IHC, Human) IHC Human
Varma S, Mahavadi P, Sasikumar S et al. Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis. Am J Physiol Lung Cell Mol Physiol 2014 Mar 1 [PMID: 24375798] (ICC/IF, Mouse) ICC/IF Mouse
Cieply B, Farris J, Denvir J et al. Epithelial-mesenchymal transition and tumor suppression are controlled by a reciprocal feedback loop between ZEB1 and Grainyhead-like-2. Cancer Res 2013 Oct 15 [PMID: 23943797] (ChIP) ChIP
Gao X, Vockley CM, Pauli F et al. Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium. Proc Natl Acad Sci U S A 2013 Jun 4 [PMID: 23690579]
Varma S, Cao Y, Tagne JB et al. The Transcription Factors Grainyhead-like 2 and NK2-Homeobox 1 Form a Regulatory Loop That Coordinates Lung Epithelial Cell Morphogenesis and Differentiation. J Biol Chem 2012 Oct 26 [PMID: 22955271]

Reviews for GRHL2 Antibody (NBP1-88552) (0)

There are no reviews for GRHL2 Antibody (NBP1-88552). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRHL2 Antibody (NBP1-88552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRHL2 Products

Bioinformatics Tool for GRHL2 Antibody (NBP1-88552)

Discover related pathways, diseases and genes to GRHL2 Antibody (NBP1-88552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL2 Antibody (NBP1-88552)

Discover more about diseases related to GRHL2 Antibody (NBP1-88552).
 

Pathways for GRHL2 Antibody (NBP1-88552)

View related products by pathway.

PTMs for GRHL2 Antibody (NBP1-88552)

Learn more about PTMs related to GRHL2 Antibody (NBP1-88552).

Blogs on GRHL2

There are no specific blogs for GRHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL2