GRHL2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse GRHL2 Antibody - Azide and BSA Free (H00079977-A01) is a polyclonal antibody validated for use in WB and ELISA. Anti-GRHL2 Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
GRHL2 (NP_079191, 111 a.a. - 210 a.a.) partial recombinant protein with GST tag. ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS |
| Specificity |
GRHL2 - grainyhead-like 2 (Drosophila) |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
GRHL2 |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
50% Glycerol |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GRHL2 Antibody - Azide and BSA Free
Background
TFCP2L3 is a member of a family of transcription factor genes whose archetype is TFCP2 (MIM 189889), a mammalian ortholog of the Drosophila gene 'grainyhead' (grh).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA
Publications for GRHL2 Antibody (H00079977-A01)(9)
Showing Publications 1 -
9 of 9.
| Publications using H00079977-A01 |
Applications |
Species |
| Hirade K, Tanaka N, Kajino T et al. Inhibiting KRAS with CD47 and immune checkpoint overcomes intrinsic resistance to combined KRAS and immune checkpoint inhibitor therapy. Cell reports. Medicine 2025-08-26 [PMID: 40885190] |
|
|
| Chen W, Kang KL, Alshaikh A et al. Grainyhead-like 2 (GRHL2) knockout abolishes oral cancer development through reciprocal regulation of the MAP kinase and TGF-? signaling pathways. Oncogenesis 2018-05-08 [PMID: 29735981] |
|
|
| Chen W, Shin KH, Kim S et al. hTERT peptide fragment GV1001 demonstrates radioprotective and antifibrotic effects through suppression of TGF-? signaling. Int J Mol Med 2018-03-14 [PMID: 29568955] |
|
|
| Chen W, Shimane T, Kawano S et al. Human Papillomavirus 16 E6 Induces FoxM1B in Oral Keratinocytes through GRHL2. J Dent Res 2018-02-14 [PMID: 29443638] |
|
|
| Chen W, Yi JK, Shimane T et al. Grainyhead-like 2 regulates epithelial plasticity and stemness in oral cancer cells. Carcinogenesis 2016-01-01 [PMID: 26933170] |
|
|
| Werner S, Frey S, Riethdorf S et al. Dual Roles of the Transcription Factor Grainyhead-like 2 (GRHL2) in Breast Cancer. J Biol Chem. 2013-06-29 [PMID: 23814079] |
|
|
| Chen W, Xiao Liu Z, Oh JE et al. Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism. Cell Death Dis. 2012-12-28 [PMID: 23254293] |
|
|
| Chen W, Dong Q, Shin KH et al. Grainyhead-like 2 Enhances the Human Telomerase Reverse Transcriptase Gene Expression by Inhibiting DNA Methylation at the 5'-CpG Island in Normal Human Keratinocytes. J Biol Chem. 2010-10-11 [PMID: 20938050] |
|
|
| Kang X, Chen W, Kim RH et al. Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells. Oncogene. 2009-01-29 [PMID: 19015635] |
|
|
Reviews for GRHL2 Antibody (H00079977-A01) (0)
There are no reviews for GRHL2 Antibody (H00079977-A01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GRHL2 Antibody (H00079977-A01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRHL2 Products
Blogs on GRHL2