GRHL2 Antibody - Azide and BSA Free

Western Blot: GRHL2 Antibody [H00079977-A01] - Detection against Immunogen (37.11 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GRHL2 Antibody - Azide and BSA Free Summary

• Immunogen: GRHL2 (NP_079191, 111 a.a. - 210 a.a.) partial recombinant protein with GST tag. ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
• Specificity: GRHL2 - grainyhead-like 2 (Drosophila)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GRHL2
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRHL2 Antibody - Azide and BSA Free

• BOMMGC149294
• Brother of mammalian grainyhead
• deafness, autosomal dominant 28
• DFNA28
• FLJ13782
• grainyhead-like 2 (Drosophila)
• grainyhead-like protein 2 homolog
• TFCP2L3MGC149295
• Transcription factor CP2-like 3FLJ11172

Background

TFCP2L3 is a member of a family of transcription factor genes whose archetype is TFCP2 (MIM 189889), a mammalian ortholog of the Drosophila gene 'grainyhead' (grh).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRHL2 Antibody (H00079977-A01)(8)

Publications using H00079977-A01

• Chen W, Kang KL, Alshaikh A et al. Grainyhead-like 2 (GRHL2) knockout abolishes oral cancer development through reciprocal regulation of the MAP kinase and TGF-? signaling pathways. Oncogenesis 2018-05-08 [PMID: 29735981]
• Chen W, Shin KH, Kim S et al. hTERT peptide fragment GV1001 demonstrates radioprotective and antifibrotic effects through suppression of TGF-? signaling. Int J Mol Med 2018-03-14 [PMID: 29568955]
• Chen W, Shimane T, Kawano S et al. Human Papillomavirus 16 E6 Induces FoxM1B in Oral Keratinocytes through GRHL2. J Dent Res 2018-02-14 [PMID: 29443638]
• Chen W, Yi JK, Shimane T et al. Grainyhead-like 2 regulates epithelial plasticity and stemness in oral cancer cells. Carcinogenesis 2016-01-01 [PMID: 26933170]
• Werner S, Frey S, Riethdorf S et al. Dual Roles of the Transcription Factor Grainyhead-like 2 (GRHL2) in Breast Cancer. J Biol Chem. 2013-06-29 [PMID: 23814079]
• Chen W, Xiao Liu Z, Oh JE et al. Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism. Cell Death Dis. 2012-12-28 [PMID: 23254293]
• Chen W, Dong Q, Shin KH et al. Grainyhead-like 2 Enhances the Human Telomerase Reverse Transcriptase Gene Expression by Inhibiting DNA Methylation at the 5'-CpG Island in Normal Human Keratinocytes. J Biol Chem. 2010-10-11 [PMID: 20938050]
• Kang X, Chen W, Kim RH et al. Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells. Oncogene. 2009-01-29 [PMID: 19015635]

Bioinformatics

• Gene Symbol: GRHL2
• Entrez:
  • 79977(Human)
• OMIM:
  • 608576(Human)
• Uniprot:
  • NP_079191(Human)