GPR175 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GPR175 Antibody [NBP2-13470] - Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemistry-Paraffin: GPR175 Antibody [NBP2-13470] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR175 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR175 Protein (NBP2-13470PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR175 Antibody

  • adipocyte associated 1
  • transmembrane protein, adipocyte asscociated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
H00008636-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB100-61040
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84369
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76243
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR175 Antibody (NBP2-13470) (0)

There are no publications for GPR175 Antibody (NBP2-13470).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR175 Antibody (NBP2-13470) (0)

There are no reviews for GPR175 Antibody (NBP2-13470). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GPR175 Antibody (NBP2-13470) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR175 Products

Bioinformatics Tool for GPR175 Antibody (NBP2-13470)

Discover related pathways, diseases and genes to GPR175 Antibody (NBP2-13470). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR175 Antibody (NBP2-13470)

Discover more about diseases related to GPR175 Antibody (NBP2-13470).

Research Areas for GPR175 Antibody (NBP2-13470)

Find related products by research area.

Blogs on GPR175

There are no specific blogs for GPR175, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR175 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPRA1