GPR175 Antibody

Western Blot: GPR175 Antibody [NBP2-13470] - Analysis in control (vector only transfected HEK293T lysate) and TPRA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: GPR175 Antibody [NBP2-13470] - Immunofluorescent staining of human cell line SiHa shows localization to vesicles.

Immunohistochemistry-Paraffin: GPR175 Antibody [NBP2-13470] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GPR175 Antibody [NBP2-13470] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GPR175 Antibody [NBP2-13470] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: GPR175 Antibody [NBP2-13470] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.

Product Discontinued

GPR175 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPRA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR175 Antibody

• adipocyte associated 1
• transmembrane protein, adipocyte asscociated 1

Background

LOC51210 is an Orphan-U GPCR with an unknown ligand. LOC51210 has been implicated in the effects of ischemic hypoxia and reoxygenation. Expression of LOC51210 has been documented in human heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from B-cell/lung/testis, blood, brain, breast, eye, heart/melanocyte/uterus, liver, liver/spleen, lymph node, nerve, ovary, prostate, and uterus libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPRA1