GPR155 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GPR155 Antibody [NBP2-56118] - Staining of human cell line SH-SY5Y shows localization to nuclear bodies & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR155 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR155 Antibody - BSA Free (NBP2-56118) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR155
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPR155 Recombinant Protein Antigen (NBP2-56118PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR155 Antibody - BSA Free

• DEP.7
• DEPDC3
• FLJ31819
• FLJ39346
• G protein-coupled receptor 155
• integral membrane protein GPR155
• PGR22G-protein coupled receptor PGR22

Background

GPR155 (G protein-coupled receptor 155) is an 870 amino acid multi-pass membrane protein. Mutations in this protein have been associated with autism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR155