AKAP12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AKAP12 Antibody [NBP1-89168] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human testis shows strong cytoplasmic and membranous positivity in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
AKAP12 Recombinant Protein Antigen (NBP1-89168PEP)
Publications
Read Publication using
NBP1-89168 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25748058).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP12 Antibody

  • A kinase (PRKA) anchor protein (gravin) 12
  • A kinase (PRKA) anchor protein 12
  • AKAP 250
  • AKAP250250kDa
  • DKFZp686M0430
  • DKFZp686O0331
  • FLJ20945
  • FLJ97621
  • Gravin
  • kinase scaffold protein gravin
  • myasthenia gravis autoantigen gravin
  • Myasthenia gravis autoantigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF

Publications for AKAP12 Antibody (NBP1-89168)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for AKAP12 Antibody (NBP1-89168) (0)

There are no reviews for AKAP12 Antibody (NBP1-89168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AKAP12 Antibody (NBP1-89168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP12 Products

Bioinformatics Tool for AKAP12 Antibody (NBP1-89168)

Discover related pathways, diseases and genes to AKAP12 Antibody (NBP1-89168). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP12 Antibody (NBP1-89168)

Discover more about diseases related to AKAP12 Antibody (NBP1-89168).
 

Pathways for AKAP12 Antibody (NBP1-89168)

View related products by pathway.

PTMs for AKAP12 Antibody (NBP1-89168)

Learn more about PTMs related to AKAP12 Antibody (NBP1-89168).
 

Research Areas for AKAP12 Antibody (NBP1-89168)

Find related products by research area.

Blogs on AKAP12

There are no specific blogs for AKAP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP12
Entrez
Uniprot