AKAP12 Antibody - BSA Free

Western Blot: AKAP12 Antibody [NBP1-89168] - Analysis in human cell lines U-251MG and MCF-7 using anti-AKAP12 antibody. Corresponding AKAP12 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: AKAP12 Antibody [NBP1-89168] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining in human testis and skeletal muscle tissues using NBP1-89168 antibody. Corresponding AKAP12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human endometrium shows moderate positivity in cells in endometrial stroma.

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human endometrium, kidney, skeletal muscle and testis using Anti-AKAP12 antibody NBP1-89168 (A) shows similar protein distribution across tissues to independent antibody NBP2-38786 (B).

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human kidney shows strong positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: AKAP12 Antibody [NBP1-89168] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AKAP12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AKAP12 Antibody - BSA Free (NBP1-89168) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-AKAP12 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKAP12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100
• Control Peptide:

  AKAP12 Recombinant Protein Antigen (NBP1-89168PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AKAP12 Antibody - BSA Free

• A kinase (PRKA) anchor protein (gravin) 12
• A kinase (PRKA) anchor protein 12
• AKAP 250
• AKAP250250kDa
• DKFZp686M0430
• DKFZp686O0331
• FLJ20945
• FLJ97621
• Gravin
• kinase scaffold protein gravin
• myasthenia gravis autoantigen gravin
• Myasthenia gravis autoantigen

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed in endothelial cells, cultured fibroblasts, and osteosarcoma cells. It associates with protein kinases A and C and phosphatase, and serves as a scaffold protein in signal transduction. This protein and RII PKA colocalize at the cell periphery. This protein is a cell growth-related protein. Antibodies to this protein can be produced by patients with myasthenia gravis. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AKAP12 Antibody (NBP1-89168)(1)

Publication using NBP1-89168

• Bateman NW, Jaworski E, Ao W et al. Elevated AKAP12 in Paclitaxel-Resistant Serous Ovarian Cancer Cells is Prognostic and Predictive of Poor Survival in Patients. J Proteome Res 2015-04-03 [PMID: 25748058] (WB, Human)

Bioinformatics

• Gene Symbol: AKAP12
• Entrez:
  • 9590(Human)
• Uniprot:
  • Q02952(Human)