GPIP137 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of U-2 OS cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: GPIP137 Antibody [NBP3-38483] - Western blot analysis of lysates from HeLa cells, using GPIP137 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of L929 cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: GPIP137 Antibody [NBP3-38483] - Western blot analysis of lysates from Mouse brain, using GPIP137 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of C6 cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPIP137 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GPIP137 (NP_005889.3).
  
  Sequence:
  AEEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQPNQVPVQPEATQVPLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPRIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPIP137 Antibody - BSA Free

• activation/proliferation-associated protein 1
• caprin 1
• caprin-1
• cell cycle associated protein 1
• Cell cycle-associated protein 1
• Cytoplasmic activation- and proliferation-associated protein 1
• cytoplasmic activation/proliferation-associated protein-1
• GPI-anchored membrane protein 1GPIP137
• GPI-p137
• M11S1GPI-anchored protein p137
• Membrane component chromosome 11 surface marker 1
• membrane component, chromosome 11, surface marker 1
• p137GPI
• RNA granule protein 105
• RNG105GPIAP1

Background

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPRIN1