GPI8 Antibody

Images

 
Western Blot: GPI8 Antibody [NBP1-69262] - This Anti-PIGK antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPI8 Antibody Summary

Immunogen
Synthetic peptides corresponding to PIGK(phosphatidylinositol glycan anchor biosynthesis, class K) The peptide sequence was selected from the N terminal of PIGK. Peptide sequence SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PIGK and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPI8 Antibody

  • EC 3.-
  • GPI transamidase subunit
  • GPI transamidase
  • GPI8 homolog
  • GPI8class K
  • GPI-anchor transamidase
  • hGPI8
  • MGC22559
  • phosphatidylinositol glycan anchor biosynthesis, class K
  • Phosphatidylinositol-glycan biosynthesis class K protein
  • PIG-K

Background

PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-62435
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
AF6386
Species: Hu
Applications: WB, IP
NBP1-62449
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GPI8 Antibody (NBP1-69262) (0)

There are no publications for GPI8 Antibody (NBP1-69262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPI8 Antibody (NBP1-69262) (0)

There are no reviews for GPI8 Antibody (NBP1-69262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPI8 Antibody (NBP1-69262) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPI8 Products

Bioinformatics Tool for GPI8 Antibody (NBP1-69262)

Discover related pathways, diseases and genes to GPI8 Antibody (NBP1-69262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPI8 Antibody (NBP1-69262)

Discover more about diseases related to GPI8 Antibody (NBP1-69262).
 

Pathways for GPI8 Antibody (NBP1-69262)

View related products by pathway.

PTMs for GPI8 Antibody (NBP1-69262)

Learn more about PTMs related to GPI8 Antibody (NBP1-69262).

Blogs on GPI8

There are no specific blogs for GPI8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPI8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGK
Uniprot