gp130/CD130 Antibody

Images

 
Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

gp130/CD130 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL6ST
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP)
Publications
Read Publication using NBP1-88138.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 19396608)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gp130/CD130 Antibody

  • CD130 antigen
  • CD130
  • CDw130
  • DKFZp564F053
  • gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
  • gp130
  • IL-6 receptor subunit beta
  • IL-6R subunit beta
  • IL-6RB
  • IL-6R-beta
  • IL6ST
  • interleukin 6 signal transducer (gp130, oncostatin M receptor)
  • interleukin receptor beta chain
  • interleukin-6 receptor subunit beta
  • Interleukin-6 signal transducer
  • Membrane glycoprotein 130
  • membrane glycoprotein gp130
  • Oncostatin-M receptor subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
557-NT/CF
Species: Rt
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2988
Species: Mu, Rt
Applications: WB

Publications for gp130/CD130 Antibody (NBP1-88138)(1)

Reviews for gp130/CD130 Antibody (NBP1-88138) (0)

There are no reviews for gp130/CD130 Antibody (NBP1-88138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for gp130/CD130 Antibody (NBP1-88138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gp130/CD130 Products

Bioinformatics Tool for gp130/CD130 Antibody (NBP1-88138)

Discover related pathways, diseases and genes to gp130/CD130 Antibody (NBP1-88138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gp130/CD130 Antibody (NBP1-88138)

Discover more about diseases related to gp130/CD130 Antibody (NBP1-88138).
 

Pathways for gp130/CD130 Antibody (NBP1-88138)

View related products by pathway.

PTMs for gp130/CD130 Antibody (NBP1-88138)

Learn more about PTMs related to gp130/CD130 Antibody (NBP1-88138).
 

Research Areas for gp130/CD130 Antibody (NBP1-88138)

Find related products by research area.

Blogs on gp130/CD130

There are no specific blogs for gp130/CD130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gp130/CD130 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6ST
Entrez