gp130/CD130 Antibody - BSA Free

Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human plasma shows moderate positivity.

Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human tonsil shows strong cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: gp130/CD130 Antibody [NBP1-88138] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

gp130/CD130 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit gp130/CD130 Antibody - BSA Free (NBP1-88138) is a polyclonal antibody validated for use in IHC. Anti-gp130/CD130 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL6ST
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 19396608)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for gp130/CD130 Antibody - BSA Free

• CD130 antigen
• CD130
• CDw130
• DKFZp564F053
• gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
• gp130
• IL-6 receptor subunit beta
• IL-6R subunit beta
• IL-6RB
• IL-6R-beta
• IL6ST
• interleukin 6 signal transducer (gp130, oncostatin M receptor)
• interleukin receptor beta chain
• interleukin-6 receptor subunit beta
• Interleukin-6 signal transducer
• Membrane glycoprotein 130
• membrane glycoprotein gp130
• Oncostatin-M receptor subunit alpha

Background

CD130 is encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for gp130/CD130 Antibody (NBP1-88138)(1)

Publication using NBP1-88138

• Rognum IJ, Haynes RL, Vege A et al. Interleukin-6 and the serotonergic system of the medulla oblongata in the sudden infant death syndrome. Acta Neuropathol 2009-10-01 [PMID: 19396608]

Bioinformatics

• Gene Symbol: IL6ST