GOT2 Antibody - BSA Free

Western Blot: GOT2 Antibody [NBP1-80521] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: GOT2 Antibody [NBP1-80521] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

GOT2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human GOT2. Peptide sequence AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOT2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for GOT2 Antibody - BSA Free

• aspartate aminotransferase, mitochondrial
• EC 2.6.1
• EC 2.6.1.1
• FABP-1
• FABPpm
• Fatty acid-binding protein
• FLJ40994
• Glutamate oxaloacetate transaminase 2
• glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase2)
• KAT4
• KATIV
• kynurenine aminotransferase IV
• mAspAT
• mitAAT
• Plasma membrane-associated fatty acid-binding protein
• Transaminase A

Background

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOT2 Antibody (NBP1-80521)(2)

Publications using NBP1-80521

• Remacha L, Comino-Mendez I, Richter S et al. Targeted exome sequencing of Krebs cycle genes reveals candidate cancer predisposing mutations in pheochromocytomas and paragangliomas Clin. Cancer Res. 2017-07-18 [PMID: 28720665] (WB, Human)
• Remacha Medina L Identification of new phaeochromocytoma and paraganglioma susceptibility genes Thesis (WB, IHC-P, KD, Human)

Bioinformatics

• Gene Symbol: GOT2
• Uniprot:
  • NP_002071(Human)