GOLPH4 Antibody - BSA Free

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human liver shows strong cytoplasmic positivity with granular pattern in hepatocytes.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human skin shows low expression as expected.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human small intestine shows high expression.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human liver.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human cerebral cortex, liver, skin and small intestine using Anti-GOLIM4 antibody NBP1-91955 (A) shows similar protein distribution across tissues to independent antibody NBP1-91954 (B).

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human small intestine shows strong positivity in Golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons and glial cells.

Immunohistochemistry-Paraffin: GOLPH4 Antibody [NBP1-91955] - Staining of human skin shows moderate granular cytoplasmic positivity in a small subset of squamous epithelial cells.

Analysis in human small intestine and skin tissues using NBP1-91955 antibody. Corresponding GOLIM4 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GOLPH4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GOLPH4 Antibody - BSA Free (NBP1-91955) is a polyclonal antibody validated for use in IHC. Anti-GOLPH4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLIM4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GOLPH4 Protein (NBP1-91955PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GOLPH4 Antibody - BSA Free

• GIMPc
• GIMPCcis
• golgi integral membrane protein 4
• Golgi phosphoprotein 4130 kDa golgi-localized phosphoprotein
• Golgi phosphoprotein of 130 kDa
• GPP130Golgi-localized phosphoprotein of 130 kDa

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GOLPH4 Antibody (NBP1-91955)(1)

Publication using NBP1-91955

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: GOLIM4