Golgi Glycoprotein 1/GLG1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Golgi Glycoprotein 1/GLG1 Antibody [NBP1-90636] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Golgi Glycoprotein 1/GLG1 Antibody [NBP1-90636] - Staining of human placenta shows strong dot like cytoplasmic positivity in trophoblastic and decidual cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center and non-germinal center cells.

Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.

Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Golgi Glycoprotein 1/GLG1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 30287345).
• Control Peptide:

  Golgi Glycoprotein 1/GLG1 Protein (NBP1-90636PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25379943). Mouse reactivity reported in (PMID: 30287345).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Golgi Glycoprotein 1/GLG1 Antibody - BSA Free

• CFR1
• CFR-1
• cysteine-rich fibroblast growth factor receptor
• DKFZp686L08213
• E-selectin ligand 1
• ESL1
• ESL-1
• FLJ23319
• FLJ23967
• FLJ32797
• GLG1
• Golgi apparatus protein 1
• Golgi Glycoprotein 1
• golgi sialoglycoprotein MG-160
• MG160
• MG-160

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Golgi Glycoprotein 1/GLG1 Antibody (NBP1-90636)(2)

Publications using NBP1-90636

• Bansal A, kirschner M, Zu L et al. Coconut Oil Decreases Expression of Amyloid Precursor Protein (APP) and Secretion of Amyloid Peptides throughInhibitionof ADP-ribosylation factor 1 (ARF1). Brain Res. 2018-10-01 [PMID: 30287345] (WB, Mouse)
• Morisaki T, Yashiro M, Kakehashi A, et al. Comparative Proteomics Analysis of Gastric Cancer Stem Cells PLos One. 2014-11-07 [PMID: 25379943] (IF/IHC, Human)
  
  Details:
  Chorein/VPS13A antibody used for IHC- P at 1:500 dilution on gastric cancer tissue specimens - antigen retrieval for 10 minutes at 105C by autoclave in Target Retrieval Solution, endogenous peroxidase blocked with 3%H2O2, On/4C incubation for primary, streptavidin-peroxidase-DAB detection (Figure 3).

Bioinformatics

• Gene Symbol: GLG1