GODZ Antibody


Immunohistochemistry-Paraffin: GODZ Antibody [NBP1-91951] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GODZ Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPTT
Specificity of human GODZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GODZ Recombinant Protein Antigen (NBP1-91951PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GODZ Antibody

  • DHHC domain containing 3
  • DKFZp313D2314
  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ20209
  • FLJ45940
  • Protein DHHC1
  • ZDHC3
  • zinc finger, DHHC-type containing 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for GODZ Antibody (NBP1-91951) (0)

There are no publications for GODZ Antibody (NBP1-91951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GODZ Antibody (NBP1-91951) (0)

There are no reviews for GODZ Antibody (NBP1-91951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GODZ Antibody (NBP1-91951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GODZ Antibody (NBP1-91951)

Discover related pathways, diseases and genes to GODZ Antibody (NBP1-91951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GODZ Antibody (NBP1-91951)

Discover more about diseases related to GODZ Antibody (NBP1-91951).

Pathways for GODZ Antibody (NBP1-91951)

View related products by pathway.

Blogs on GODZ

There are no specific blogs for GODZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GODZ Antibody and receive a gift card or discount.


Gene Symbol ZDHHC3