GODZ Antibody

Images

 
Western Blot: GODZ Antibody [NBP1-68903] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GODZ Antibody Summary

Immunogen
Synthetic peptides corresponding to ZDHHC3 (zinc finger, DHHC-type containing 3) The peptide sequence was selected from the C terminal of ZDHHC3. Peptide sequence MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZDHHC3 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GODZ Antibody

  • DHHC domain containing 3
  • DKFZp313D2314
  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ20209
  • FLJ45940
  • Protein DHHC1
  • zinc finger, DHHC-type containing 3

Background

ZDHHC3 is a palmitoyltransferase with broad specificity. ZDHHC3 palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. ZDHHC3 palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83822
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-88607
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NB300-190
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-80896
Species: Hu
Applications: IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-68903
Species: Hu
Applications: WB

Publications for GODZ Antibody (NBP1-68903) (0)

There are no publications for GODZ Antibody (NBP1-68903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GODZ Antibody (NBP1-68903) (0)

There are no reviews for GODZ Antibody (NBP1-68903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GODZ Antibody (NBP1-68903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GODZ Products

Bioinformatics Tool for GODZ Antibody (NBP1-68903)

Discover related pathways, diseases and genes to GODZ Antibody (NBP1-68903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GODZ Antibody (NBP1-68903)

Discover more about diseases related to GODZ Antibody (NBP1-68903).
 

Pathways for GODZ Antibody (NBP1-68903)

View related products by pathway.

Blogs on GODZ

There are no specific blogs for GODZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GODZ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC3
Uniprot