GNPTG Antibody - BSA Free

Immunohistochemistry-Paraffin: GNPTG Antibody [NBP1-88443] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and GNPTG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNPTG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GNPTG Antibody - BSA Free (NBP1-88443) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNPTG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GNPTG Protein (NBP1-88443PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNPTG Antibody - BSA Free

• C16orf27
• c316G12.3
• CAB56184
• GlcNAc-1-phosphotransferase subunit gamma
• GNPTAGchromosome 16 open reading frame 27
• LP2537
• N-acetylglucosamine-1-phosphate transferase, gamma subunit
• N-acetylglucosamine-1-phosphotransferase subunit gamma
• N-acetylglucosamine-1-phosphotransferase, gamma subunit
• RJD9
• UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma

Background

GNPTG, also known as N-acetylglucosamine-1-phosphotransferase subunit gamma, is a 305 amino acid that is 34 kDa,; hexamer composed of two alpha, two beta and two gamma subunits, widely expressed; catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker, essential for targeting of lysosomal hydrolases to the lysosome. Studies are being performed on the relationship of this protein to mucolipidosis iii gamma, mucolipidosis, mucolipidosis iiic, mucolipidosis ii, dysostosis, short stature, autosomal recessive disease, scoliosis, parkinson's disease, ovarian carcinoma, and retinitis. GNPTG protein involvement has been observed with relation to UPF1 and GNPTAB proteins in the lysosome pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNPTG