GNPTG Antibody

Images

 
Western Blot: GNPTG Antibody [NBP1-88443] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: GNPTG Antibody [NBP1-88443] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNPTG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNPTG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GNPTG Protein (NBP1-88443PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNPTG Antibody

  • C16orf27
  • c316G12.3
  • CAB56184
  • GlcNAc-1-phosphotransferase subunit gamma
  • GNPTAGchromosome 16 open reading frame 27
  • LP2537
  • N-acetylglucosamine-1-phosphate transferase, gamma subunit
  • N-acetylglucosamine-1-phosphotransferase subunit gamma
  • N-acetylglucosamine-1-phosphotransferase, gamma subunit
  • RJD9
  • UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55327
Species: Hu
Applications: ICC/IF
NBP2-38041
Species: Hu
Applications: IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
AF2485
Species: Hu
Applications: WB, IHC, IP
MAB5469
Species: Hu
Applications: WB, ICC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49387
Species: Hu
Applications: IHC, IHC-P
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
NBP1-88443
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GNPTG Antibody (NBP1-88443) (0)

There are no publications for GNPTG Antibody (NBP1-88443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNPTG Antibody (NBP1-88443) (0)

There are no reviews for GNPTG Antibody (NBP1-88443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNPTG Antibody (NBP1-88443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNPTG Products

Bioinformatics Tool for GNPTG Antibody (NBP1-88443)

Discover related pathways, diseases and genes to GNPTG Antibody (NBP1-88443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNPTG Antibody (NBP1-88443)

Discover more about diseases related to GNPTG Antibody (NBP1-88443).
 

Pathways for GNPTG Antibody (NBP1-88443)

View related products by pathway.

PTMs for GNPTG Antibody (NBP1-88443)

Learn more about PTMs related to GNPTG Antibody (NBP1-88443).

Blogs on GNPTG

There are no specific blogs for GNPTG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNPTG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPTG