GNPTAB Antibody

Images

 
Western Blot: GNPTAB Antibody [NBP1-91347] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNPTAB Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human GNPTAB (NP_077288). Peptide sequence FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNPTAB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
144 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNPTAB Antibody

  • DKFZp762B226
  • GlcNAc phosphotransferase
  • glucosamine (UDP-N-acetyl)-lysosomal-enzyme N-acetylglucosamine phosphotransferase
  • GNPTA
  • ICD
  • KIAA1208
  • MGC4170
  • N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits
  • stealth protein GNPTAB
  • UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosamine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP2-11567
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49579
Species: Hu
Applications: IHC, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NBP2-04611
Species: Hu
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2905
Species: Hu
Applications: WB, ELISA, ICC
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91347
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for GNPTAB Antibody (NBP1-91347) (0)

There are no publications for GNPTAB Antibody (NBP1-91347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNPTAB Antibody (NBP1-91347) (0)

There are no reviews for GNPTAB Antibody (NBP1-91347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNPTAB Antibody (NBP1-91347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GNPTAB Products

Bioinformatics Tool for GNPTAB Antibody (NBP1-91347)

Discover related pathways, diseases and genes to GNPTAB Antibody (NBP1-91347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNPTAB Antibody (NBP1-91347)

Discover more about diseases related to GNPTAB Antibody (NBP1-91347).
 

Pathways for GNPTAB Antibody (NBP1-91347)

View related products by pathway.

PTMs for GNPTAB Antibody (NBP1-91347)

Learn more about PTMs related to GNPTAB Antibody (NBP1-91347).

Blogs on GNPTAB

There are no specific blogs for GNPTAB, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNPTAB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPTAB
Entrez
Uniprot