GNL3L Antibody

Images

 
Western Blot: GNL3L Antibody [NBP1-55241] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Immunocytochemistry/ Immunofluorescence: GNL3L Antibody [NBP1-55241] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml
Western Blot: GNL3L Antibody [NBP1-55241] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNL3L Antibody Summary

Immunogen
Synthetic peptides corresponding to GNL3L(guanine nucleotide binding protein-like 3 (nucleolar)-like) The peptide sequence was selected from the N terminal of GNL3L. Peptide sequence QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNL3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
Application Notes
This is a rabbit polyclonal antibody against GNL3L and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GNL3L Antibody

  • EC 3.6.1
  • FLJ10613
  • guanine nucleotide binding protein-like 3 (nucleolar)-like
  • guanine nucleotide-binding protein-like 3-like protein
  • novel GTPase

Background

GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP2-01360
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-81649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-16450
Species: Hu
Applications: WB, ICC/IF
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for GNL3L Antibody (NBP1-55241) (0)

There are no publications for GNL3L Antibody (NBP1-55241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNL3L Antibody (NBP1-55241) (0)

There are no reviews for GNL3L Antibody (NBP1-55241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNL3L Antibody (NBP1-55241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNL3L Products

Bioinformatics Tool for GNL3L Antibody (NBP1-55241)

Discover related pathways, diseases and genes to GNL3L Antibody (NBP1-55241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNL3L Antibody (NBP1-55241)

Discover more about diseases related to GNL3L Antibody (NBP1-55241).
 

Pathways for GNL3L Antibody (NBP1-55241)

View related products by pathway.

PTMs for GNL3L Antibody (NBP1-55241)

Learn more about PTMs related to GNL3L Antibody (NBP1-55241).

Blogs on GNL3L

There are no specific blogs for GNL3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNL3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNL3L
Uniprot