GNL2 Antibody

Images

 
Western Blot: GNL2 Antibody [NBP1-81649] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GNL2 Antibody [NBP1-81649] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. Antibody staining shown in green.
Immunohistochemistry-Paraffin: GNL2 Antibody [NBP1-81649] - Staining of human gall bladder shows distinct nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVPQFSGDDLVPV
Specificity
Specificity of human GNL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNL2 Protein (NBP1-81649PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNL2 Antibody

  • Autoantigen NGP-1
  • FLJ40906
  • guanine nucleotide binding protein-like 2 (nucleolar)
  • HUMAUANTIG
  • Ngp-1
  • NGP1novel nucleolar guanosine 5'-triphosphate binding protein autoantigen
  • nucleolar G-protein gene 1
  • nucleolar GTPase
  • nucleolar GTP-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-14062
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-15548
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84618
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-01360
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GNL2 Antibody (NBP1-81649) (0)

There are no publications for GNL2 Antibody (NBP1-81649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNL2 Antibody (NBP1-81649) (0)

There are no reviews for GNL2 Antibody (NBP1-81649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNL2 Antibody (NBP1-81649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GNL2 Antibody (NBP1-81649)

Discover related pathways, diseases and genes to GNL2 Antibody (NBP1-81649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNL2 Antibody (NBP1-81649)

Discover more about diseases related to GNL2 Antibody (NBP1-81649).
 

Pathways for GNL2 Antibody (NBP1-81649)

View related products by pathway.

Blogs on GNL2

There are no specific blogs for GNL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNL2