![Western Blot: GMPPA Antibody [NBP1-85904] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/GMPPA-Antibody-Western-Blot-NBP1-85904-img0005.jpg "Western Blot: GMPPA Antibody [NBP1-85904] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit GMPPA Antibody - BSA Free (NBP1-85904) is a polyclonal antibody validated for use in IHC and WB. Anti-GMPPA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GMPPA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 30072579). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 46 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
| Publication using NBP1-85904 | Applications | Species |
|---|---|---|
| Saarinen L, Nummela P, Leinonen H et al. Glycomic Profiling Highlights Increased Fucosylation in Pseudomyxoma Peritonei Mol. Cell Proteomics 2018-08-02 [PMID: 30072579] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for GMPPA Antibody (NBP1-85904)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/GMPPA-Antibody-Immunohistochemistry-Paraffin-NBP1-85904-img0008.jpg "Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/GMPPA-Antibody-Immunohistochemistry-Paraffin-NBP1-85904-img0006.jpg "Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GMPPA-Antibody-Immunohistochemistry-Paraffin-NBP1-85904-img0007.jpg "Immunohistochemistry-Paraffin: GMPPA Antibody [NBP1-85904] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")