GMFG Antibody

Product Discontinued

GMFG Antibody Summary

• Immunogen: Synthetic peptides corresponding to GMFG(glia maturation factor, gamma) The peptide sequence was selected from the middle region of GMFG. Peptide sequence KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY.
• Predicted Species: Mouse (100%), Rat (93%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GMFG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against GMFG and was validated on Western blot.
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GMFG Antibody

• glia maturation factor gamma
• glia maturation factor, gamma
• GMF-GAMMA
• MGC126867

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GMFG
• Uniprot:
  • O60234(Human)