GMEB1 Antibody

Images

 
Orthogonal Strategies: Western Blot: GMEB1 Antibody [NBP2-55657] - Analysis in human cell lines U-251MG and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: GMEB1 Antibody [NBP2-55657] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GMEB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEI
Specificity
Specificity of human GMEB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMEB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GMEB1 Antibody

  • DNA-binding protein p96PIF
  • glucocorticoid modulatory element binding protein 1
  • glucocorticoid modulatory element-binding protein 1
  • GMEB-1
  • P96PIF
  • Parvovirus initiation factor p96
  • PIF p96
  • PIF96

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81421
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57690
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-47281
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79286
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Ze
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for GMEB1 Antibody (NBP2-55657) (0)

There are no publications for GMEB1 Antibody (NBP2-55657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMEB1 Antibody (NBP2-55657) (0)

There are no reviews for GMEB1 Antibody (NBP2-55657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMEB1 Antibody (NBP2-55657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GMEB1 Products

Bioinformatics Tool for GMEB1 Antibody (NBP2-55657)

Discover related pathways, diseases and genes to GMEB1 Antibody (NBP2-55657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMEB1 Antibody (NBP2-55657)

Discover more about diseases related to GMEB1 Antibody (NBP2-55657).
 

Pathways for GMEB1 Antibody (NBP2-55657)

View related products by pathway.

PTMs for GMEB1 Antibody (NBP2-55657)

Learn more about PTMs related to GMEB1 Antibody (NBP2-55657).

Blogs on GMEB1

There are no specific blogs for GMEB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMEB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMEB1