Glypican 6 Antibody

Immunocytochemistry/Immunofluorescence: Glypican 6 Antibody [NBP1-87565] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Glypican 6 Antibody [NBP1-87565] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: Glypican 6 Antibody [NBP1-87565] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.

Immunohistochemistry-Paraffin: Glypican 6 Antibody [NBP1-87565] - Staining of human duodenum shows strong immunoreactivity in apical membranes of glandular cells as well as granular cytoplasmic positivity.

Immunohistochemistry-Paraffin: Glypican 6 Antibody [NBP1-87565] - Staining of human uterine cervix shows moderate membranous positivity in squamous epithelial cells.

Product Discontinued

Glypican 6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPC6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glypican 6 Antibody

• Glypican 6
• glypican proteoglycan 6
• glypican-6
• GPC6
• MGC126288
• OMIMD1

Background

The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases. [provided by RefSeq]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no quality transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPC6