Glyoxalase I Antibody - BSA Free

Western Blot: Glyoxalase I Antibody [NBP2-56695] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody [NBP2-56695] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glyoxalase I Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glyoxalase I Antibody - BSA Free (NBP2-56695) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Glyoxalase I Recombinant Protein Antigen (NBP2-56695PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glyoxalase I Antibody - BSA Free

• Aldoketomutase
• EC 4.4.1.5
• GLO1
• GLOD1
• Glx I
• GLYI
• glyoxalase domain containing 1
• Glyoxalase I
• glyoxalase Ialdoketomutase
• Ketone-aldehyde mutase
• lactoyl glutathione lyase
• lactoylglutathione lyase
• Methylglyoxalase
• S-D-lactoylglutathione methylglyoxal lyase

Background

Lactoylglutathione lyase, also known as GLO1, is a member of the glyoxalase I family that is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. It is believed that inactivation of GLO1 in endothelial cells contributes to vascular complications in diabetes. GLO1 has also been shown to extend lifespan in C. elegans, and has been shown to be upregulated in malignant cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLO1