Glyoxalase I Antibody (3G6Q1)

Western Blot: Glyoxalase I Antibody (3G6Q1) [NBP3-16375] - Western blot analysis of extracts of various cell lines, using Glyoxalase I Rabbit mAb (NBP3-16375) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 3G6Q1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glyoxalase I Antibody (3G6Q1) Summary

• Description: Novus Biologicals Rabbit Glyoxalase I Antibody (3G6Q1) (NBP3-16375) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glyoxalase I (Q04760). MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GLO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glyoxalase I Antibody (3G6Q1)

• Aldoketomutase
• EC 4.4.1.5
• GLO1
• GLOD1
• Glx I
• GLYI
• glyoxalase domain containing 1
• Glyoxalase I
• glyoxalase Ialdoketomutase
• Ketone-aldehyde mutase
• lactoyl glutathione lyase
• lactoylglutathione lyase
• Methylglyoxalase
• S-D-lactoylglutathione methylglyoxal lyase

Background

Lactoylglutathione lyase, also known as GLO1, is a member of the glyoxalase I family that is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. It is believed that inactivation of GLO1 in endothelial cells contributes to vascular complications in diabetes. GLO1 has also been shown to extend lifespan in C. elegans, and has been shown to be upregulated in malignant cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLO1