Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-56139] - Staining in human testis and pancreas tissues using anti-GPX4 antibody. Corresponding GPX4 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-56139] - Staining of human cell line U-251 MG shows localization to nucleoplasm and mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-56139] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-56139] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glutathione Peroxidase 4/GPX4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glutathione Peroxidase 4/GPX4 Antibody - BSA Free (NBP2-56139) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVAS
• Predicted Species: Mouse (98%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Glutathione Peroxidase 4/GPX4 Recombinant Protein Antigen (NBP2-56139PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

• EC 1.11.1
• EC 1.11.1.12
• glutathione peroxidase 4 (phospholipid hydroperoxidase)
• Glutathione Peroxidase 4
• GPX4
• GPx-4
• GSHPx-4
• MCSP
• PHGPx
• PHGPxsnGPx
• phospholipid hydroperoxidase
• phospholipid hydroperoxide glutathione peroxidase, mitochondrial
• snGPx
• snPHGPx
• sperm nucleus glutathione peroxidase

Background

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPX4