Glutathione Peroxidase 4/GPX4 Antibody

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining in human testis and pancreas tissues using anti-GPX4 antibody. Corresponding GPX4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Cyst(e)ine promotes Glutathione Peroxidase 4/GPX4 protein synthesis partly through Rag-mTORC1-4EBP signaling. l) Representative images from immunohistochemical staining of kidney tumor tissue microarray for Glutathione Peroxidase 4/GPX4 and P-4EBP1. m) Summary and statistical analysis of immunohistochemical staining results for Glutathione Peroxidase 4/GPX4 and P-4EBP1 in tumor tissue microarray. Tissue microarray analysis revealed that P-4EBP1 staining correlated with Glutathione Peroxidase 4/GPX4 level. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33707434/) licensed under a CC-BY license.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glutathione Peroxidase 4/GPX4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glutathione Peroxidase 4/GPX4 Recombinant Protein Antigen (NBP2-54979PEP)

Reactivity Notes

Use in Human reported in scientific literature (PMID:33707434).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glutathione Peroxidase 4/GPX4 Antibody

• EC 1.11.1
• EC 1.11.1.12
• glutathione peroxidase 4 (phospholipid hydroperoxidase)
• Glutathione Peroxidase 4
• GPX4
• GPx-4
• GSHPx-4
• MCSP
• PHGPx
• PHGPxsnGPx
• phospholipid hydroperoxidase
• phospholipid hydroperoxide glutathione peroxidase, mitochondrial
• snGPx
• snPHGPx
• sperm nucleus glutathione peroxidase

Background

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-54979)(1)

Publication using NBP2-54979

• Zhang Y, Swanda RV, Nie L et al. mTORC1 couples cyst(e)ine availability with GPX4 protein synthesis and ferroptosis regulation Nature communications 2021-03-11 [PMID: 33707434] (IHC-P, Human)
  
  Details:
  Immunohistochemical analysis of human tumor tissue xenografted in mice.

Bioinformatics

• Gene Symbol: GPX4