Orthogonal Strategies: Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining in human testis and pancreas tissues using anti-GPX4 antibody. Corresponding GPX4 RNA-seq data ...read more
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Cyst(e)ine promotes Glutathione Peroxidase 4/GPX4 protein synthesis partly through Rag-mTORC1-4EBP signaling. l) Representative images from ...read more
Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Cyst(e)ine promotes GPX4 protein synthesis partly through Rag-mTORC1-4EBP signaling. i WB analysis of protein expression in control (sgCon) & ...read more
Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - mTORC1 inhibition sensitizes cancer cells or tumors to ferroptosis.a UMRC6 cells were treated with 1 μM RSL3 (or 1 μM ML162), or 1 μM ...read more
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPX4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-54979) (0)
There are no reviews for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-54979).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Glutathione Peroxidase 4/GPX4 Antibody - BSA Free and receive a gift card or discount.