Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [Glutathione Peroxidase 4/GPX4] - Western blot analysis of lysates from wild type (WT) and Glutathione Peroxidase 4/GPX4 knockdown (KD) U-87 MG cells using [KD Validated] Glutathione Peroxidase 4/GPX4 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) [NBP3-15362] - Confocal imaging of paraffin-embedded Mouse testis tissue using [KD Validated] Glutathione Peroxidase 4/GPX4 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Analysis of various lysates using [KD Validated] GPX4 Rabbit mAb at 1:2000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, Mycoplasma
• Clone: 7O4Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) Summary

• Description: Novus Biologicals Rabbit Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9) (NBP3-15362) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GPX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:800
  • Knockdown Validated
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glutathione Peroxidase 4/GPX4 Antibody (7O4Q9)

• EC 1.11.1
• EC 1.11.1.12
• glutathione peroxidase 4 (phospholipid hydroperoxidase)
• Glutathione Peroxidase 4
• GPX4
• GPx-4
• GSHPx-4
• MCSP
• PHGPx
• PHGPxsnGPx
• phospholipid hydroperoxidase
• phospholipid hydroperoxide glutathione peroxidase, mitochondrial
• snGPx
• snPHGPx
• sperm nucleus glutathione peroxidase

Background

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPX4