GLUT9 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: NRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC2A9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GLUT9 Antibody - BSA Free
Background
Glucose Transporter 9 (GLUT9), or SLC2A9, is a membrane transport protein that facilitates the traffic of uric acid and fructose across plasma memebranes. GLUT-9 is also thought to be responsible for maintaining glucose homeostasis in the cell. GLUT9 defects have been linked to both hyperuricemia and gout.
GLUT9 antibodies are useful tools for research on glucose, fructose, and uric acid regulation, as well as diseases such as hyperuricemia and gout.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba
Applications: ELISA, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for GLUT9 Antibody (NBP3-16970) (0)
There are no publications for GLUT9 Antibody (NBP3-16970).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLUT9 Antibody (NBP3-16970) (0)
There are no reviews for GLUT9 Antibody (NBP3-16970).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GLUT9 Antibody (NBP3-16970) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLUT9 Products
Research Areas for GLUT9 Antibody (NBP3-16970)
Find related products by research area.
|
Blogs on GLUT9