GLUT9 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit GLUT9 Antibody - Azide and BSA Free (NBP3-02991) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 429-529 of human GLUT9 (NP_064425.2). GPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC2A9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for GLUT9 Antibody - Azide and BSA Free
Background
Glucose Transporter 9 (GLUT9), or SLC2A9, is a membrane transport protein that facilitates the traffic of uric acid and fructose across plasma memebranes. GLUT-9 is also thought to be responsible for maintaining glucose homeostasis in the cell. GLUT9 defects have been linked to both hyperuricemia and gout.
GLUT9 antibodies are useful tools for research on glucose, fructose, and uric acid regulation, as well as diseases such as hyperuricemia and gout.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba
Applications: ELISA, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for GLUT9 Antibody (NBP3-02991) (0)
There are no publications for GLUT9 Antibody (NBP3-02991).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLUT9 Antibody (NBP3-02991) (0)
There are no reviews for GLUT9 Antibody (NBP3-02991).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GLUT9 Antibody (NBP3-02991) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLUT9 Products
Research Areas for GLUT9 Antibody (NBP3-02991)
Find related products by research area.
|
Blogs on GLUT9