Recombinant Human Glut2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Glut2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32-98 of Human SLC2A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWS

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC2A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glut2 Protein

  • GLUT2 Glucose transporter type 2, liver
  • Glut2
  • GLUT-2
  • SLC2A2
  • solute carrier family 2 (facilitated glucose transporter), member 2
  • solute carrier family 2, facilitated glucose transporter member 2

Background

Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
H00144195-R01
Species: Hu
AF6014
Species: Hu, Mu, Rt
Applications: WB
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-57033
Species: Hu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF6347
Species: Hu
Applications: WB

Publications for Glut2 Partial Recombinant Protein (H00006514-Q01) (0)

There are no publications for Glut2 Partial Recombinant Protein (H00006514-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut2 Partial Recombinant Protein (H00006514-Q01) (0)

There are no reviews for Glut2 Partial Recombinant Protein (H00006514-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut2 Partial Recombinant Protein (H00006514-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glut2 Products

Bioinformatics Tool for Glut2 Partial Recombinant Protein (H00006514-Q01)

Discover related pathways, diseases and genes to Glut2 Partial Recombinant Protein (H00006514-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut2 Partial Recombinant Protein (H00006514-Q01)

Discover more about diseases related to Glut2 Partial Recombinant Protein (H00006514-Q01).
 

Pathways for Glut2 Partial Recombinant Protein (H00006514-Q01)

View related products by pathway.

PTMs for Glut2 Partial Recombinant Protein (H00006514-Q01)

Learn more about PTMs related to Glut2 Partial Recombinant Protein (H00006514-Q01).

Blogs on Glut2

There are no specific blogs for Glut2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut1 Antibody
NB110-39113
Glut2 Antibody
NBP2-22218
Glut4 Antibody
NBP1-49533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glut2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A2
Entrez