GluR2 Recombinant Protein Antigen

Product Discontinued

GluR2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRIA2.
  
  

  Source: E. coli

  Amino Acid Sequence: NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GRIA2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89765.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GluR2 Recombinant Protein Antigen

• AMPA 2
• AMPA2
• GluA2
• GluR2
• GLURB
• GluR-K2
• glutamate receptor, ionotropic, AMPA 2
• GRIA2
• HBGR2

Background

The GRIA2 gene encodes for glutamate receptor 2 with an isoform flop of 883 amino acids, 98 kDA, isoform flip of 883 amino acids and 98 kDA, and an isoform 3 of 901 amino acids long and 100 kDA. Glutamate receptors function as a ligand-gated ion channel in the central nervous system and are the predominant excitatory neurotransmitter receptors in the brain. GRIA2 has been researched regarding its role in Alzheimer's disease, multiple sclerosis, motor neuron disease, epilepsy, anorexia, bioplar disorder, and neurodegeneration. GRIA2 is involved in the CREB pathway, intracellular calcium signaling, glutamic acid signaling, and calcium channels as well as interacts with genes NSF, GRIA3, DLG4, GRID2, and SDCBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRIA2