GluR2 Antibody

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry: GluR2 Antibody [NBP1-89765] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Analysis in human cerebral cortex and liver tissues using NBP1-89765 antibody. Corresponding GRIA2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human cerebral cortex shows moderate positivity in neuropil and neurons.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human cerebellum shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Discontinued

GluR2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRIA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 18953328)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GluR2 Antibody

• AMPA 2
• AMPA2
• GluA2
• GluR2
• GLURB
• GluR-K2
• glutamate receptor, ionotropic, AMPA 2
• GRIA2
• HBGR2

Background

The GRIA2 gene encodes for glutamate receptor 2 with an isoform flop of 883 amino acids, 98 kDA, isoform flip of 883 amino acids and 98 kDA, and an isoform 3 of 901 amino acids long and 100 kDA. Glutamate receptors function as a ligand-gated ion channel in the central nervous system and are the predominant excitatory neurotransmitter receptors in the brain. GRIA2 has been researched regarding its role in Alzheimer's disease, multiple sclerosis, motor neuron disease, epilepsy, anorexia, bioplar disorder, and neurodegeneration. GRIA2 is involved in the CREB pathway, intracellular calcium signaling, glutamic acid signaling, and calcium channels as well as interacts with genes NSF, GRIA3, DLG4, GRID2, and SDCBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GluR2 Antibody (NBP1-89765)(2)

Publications using NBP1-89765

• Choi CH, Choi JJ, Park YA et al. Identification of differentially expressed genes according to chemosensitivity in advanced ovarian serous adenocarcinomas: expression of GRIA2 predicts better survival. Br J Cancer 2012-06-26 [PMID: 22644307]
• Leja J, Essaghir A, Essand M et al. Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas. Mod Pathol 2009-02-01 [PMID: 18953328]

Bioinformatics

• Gene Symbol: GRIA2