GluR2 Antibody

Images

 
Immunohistochemistry: GluR2 Antibody [NBP1-89765] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GluR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRIA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GluR2 Protein (NBP1-89765PEP)
Publications
Read Publications using NBP1-89765.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 18953328)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GluR2 Antibody

  • AMPA 2
  • AMPA2
  • GluA2
  • GluR2
  • GLURB
  • GluR-K2
  • glutamate receptor, ionotropic, AMPA 2
  • GRIA2
  • HBGR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBL1-07321
Species: Hu
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GluR2 Antibody (NBP1-89765)(2)

Reviews for GluR2 Antibody (NBP1-89765) (0)

There are no reviews for GluR2 Antibody (NBP1-89765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GluR2 Antibody (NBP1-89765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GluR2 Products

Bioinformatics Tool for GluR2 Antibody (NBP1-89765)

Discover related pathways, diseases and genes to GluR2 Antibody (NBP1-89765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GluR2 Antibody (NBP1-89765)

Discover more about diseases related to GluR2 Antibody (NBP1-89765).
 

Pathways for GluR2 Antibody (NBP1-89765)

View related products by pathway.

PTMs for GluR2 Antibody (NBP1-89765)

Learn more about PTMs related to GluR2 Antibody (NBP1-89765).
 

Research Areas for GluR2 Antibody (NBP1-89765)

Find related products by research area.

Blogs on GluR2

There are no specific blogs for GluR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GluR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIA2
Entrez