Glucuronic Acid Epimerase Recombinant Protein Antigen

Images

 
There are currently no images for Glucuronic Acid Epimerase Protein (NBP2-31985PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glucuronic Acid Epimerase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLCE.

Source: E.coli

Amino Acid Sequence: SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLCE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-31985.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Glucuronic Acid Epimerase Recombinant Protein Antigen

  • D-glucuronyl C5-epimerase
  • EC 5.1.3
  • EC 5.1.3.-
  • glucuronic acid epimerase
  • glucuronyl C5-epimerase
  • Heparin/heparan sulfate:glucuronic acid C5-epimerase
  • HSEPIheparin/heparan sulfate-glucuronic acid C5-epimerase
  • KIAA0836heparan sulfate epimerase
  • UDP-glucuronic acid epimerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB6335
Species: Hu
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
H00006275-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB110-60980
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
AF2536
Species: Mu
Applications: WB
NBP1-33208
Species: Hu
Applications: WB, ICC/IF
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31985PEP
Species: Hu
Applications: AC

Publications for Glucuronic Acid Epimerase Protein (NBP2-31985PEP) (0)

There are no publications for Glucuronic Acid Epimerase Protein (NBP2-31985PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucuronic Acid Epimerase Protein (NBP2-31985PEP) (0)

There are no reviews for Glucuronic Acid Epimerase Protein (NBP2-31985PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Glucuronic Acid Epimerase Protein (NBP2-31985PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Glucuronic Acid Epimerase Protein (NBP2-31985PEP)

Discover related pathways, diseases and genes to Glucuronic Acid Epimerase Protein (NBP2-31985PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucuronic Acid Epimerase Protein (NBP2-31985PEP)

Discover more about diseases related to Glucuronic Acid Epimerase Protein (NBP2-31985PEP).
 

Pathways for Glucuronic Acid Epimerase Protein (NBP2-31985PEP)

View related products by pathway.

PTMs for Glucuronic Acid Epimerase Protein (NBP2-31985PEP)

Learn more about PTMs related to Glucuronic Acid Epimerase Protein (NBP2-31985PEP).

Blogs on Glucuronic Acid Epimerase

There are no specific blogs for Glucuronic Acid Epimerase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glucuronic Acid Epimerase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLCE