Glucosylceramidase/GBA Antibody (2E2.)

Images

 
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.
Immunocytochemistry/ Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01), clone 2E2.Lane 1: GBA transfected lysate(60 KDa).Lane 2: ...read more
ELISA: Glucosylceramidase/GBA Antibody (2E2.) [H00002629-M01] - Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Detection limit for recombinant GST tagged GBA is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glucosylceramidase/GBA Antibody (2E2.) Summary

Immunogen
GBA (NP_000148 146 a.a. - 235 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Specificity
GBA - glucosidase, beta; acid (includes glucosylceramidase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GBA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recominant protein, transfected lysate and cell lysate for WB. It has been used for IF, IHC-P and ELISA.
Positive Control
Glucosylceramidase/GBA Lysate (NBP2-64990)
Reviewed Applications
Read 1 Review rated 5
using
H00002629-M01 in the following applications:

Publications
Read Publications using
H00002629-M01 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glucosylceramidase/GBA Antibody (2E2.)

  • Acid beta-glucosidase
  • Alglucerase
  • beta-glucocerebrosidase
  • D-glucosyl-N-acylsphingosine glucohydrolase
  • EC 3.2.1.45
  • GBA
  • GBA1
  • GC
  • GCB
  • GLUC
  • glucosidase, beta, acid
  • glucosidase, beta; acid (includes glucosylceramidase)
  • Glucosylceramidase
  • Imiglucerase
  • lysosomal glucocerebrosidase

Background

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-83363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87945
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-47396
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-45889
Species: Hu
Applications: WB, IHC
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-65033
Species: Hu
NBP1-89782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Glucosylceramidase/GBA Antibody (H00002629-M01)(6)

We have publications tested in 2 confirmed species: Human, Plant.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Plant
(1)
All Species

Review for Glucosylceramidase/GBA Antibody (H00002629-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: ansgenic mice.

Reviews using H00002629-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
ansgenic mice
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Glucosylceramidase/GBA H00002629-M01
Enlarge
reviewed by:
Steven Zhou
WB ansgenic mice 10/10/2016
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver,Mouse Spleen, Mouse brain
Speciesansgenic mice
LotG9051-2E2

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glucosylceramidase/GBA Antibody (H00002629-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Glucosylceramidase/GBA Antibody (H00002629-M01)

Discover related pathways, diseases and genes to Glucosylceramidase/GBA Antibody (H00002629-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucosylceramidase/GBA Antibody (H00002629-M01)

Discover more about diseases related to Glucosylceramidase/GBA Antibody (H00002629-M01).
 

Pathways for Glucosylceramidase/GBA Antibody (H00002629-M01)

View related products by pathway.

PTMs for Glucosylceramidase/GBA Antibody (H00002629-M01)

Learn more about PTMs related to Glucosylceramidase/GBA Antibody (H00002629-M01).
 

Research Areas for Glucosylceramidase/GBA Antibody (H00002629-M01)

Find related products by research area.

Blogs on Glucosylceramidase/GBA

There are no specific blogs for Glucosylceramidase/GBA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Steven Zhou
10/10/2016
Application: WB
Species: ansgenic mice

Bioinformatics

Gene Symbol GBA
Entrez
OMIM
Uniprot