Home » Glucosamine (N-acetyl)-6-Sulfatase/GNS » GNS Peptides and Proteins » Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein Antigen

Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNS.

Source: E.coli

Amino Acid Sequence: NYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38583.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein Antigen

  • EC 3.1.6
  • EC 3.1.6.14
  • G6Sglucosamine-6-sulfatase
  • glucosamine (N-acetyl)-6-sulfatase
  • Glucosamine6Sulfatase
  • Glucosamine-6-Sulfatase
  • GNS
  • MGC21274
  • N-acetylglucosamine-6-sulfatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Arylsulfatase
B/ARSB Antibody (7084
MAB4415
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Huh‑7 human hepatoma cell line, and human skeletal muscle tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Arylsulfatase B/ARSB Monoclonal Antibody (Catalog # MAB4415) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Arylsulfatase B/ARSB at approximately 47 to 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Arylsulfatase B/ARSB was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human Arylsulfatase B/ARSB Monoclonal Antibody (Catalog # MAB4415) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NOC2L Antibody
NBP1-92190
Western Blot: NOC2L Antibody [NBP1-92190] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: NOC2L Antibody [NBP1-92190] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: NOC2L Antibody [NBP1-92190] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract7.5% SDS-PAGE GALNS antibody dilution: 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
Immunohistochemistry-Paraffin: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:100 dilution.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
(2 Publications)
Species: Hu, Mu
Applications: WB
Cathepsin G
Antibody
NBP2-33498
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human cerebral cortex shows low expression as expected.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Nephrin Antibody
[Unconjugated]
AF3159
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using 10 µg/mL Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(19 Publications)
Species: Mu
Applications: IHC
Glycerol Kinase
Antibody
NBP1-57033
Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
KIR2.3 Antibody
(S25-35)
NBP2-12902
Western Blot: KIR2.3 Antibody (S25-35) [NBP2-12902] - analysis of Human Cell lysates showing detection of Kir2.3 Potassium Channel protein using Mouse Anti-Kir2.3 Potassium Channel Monoclonal Antibody, Clone S25-35. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Kir2.3 Potassium Channel Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: KIR2.3 Antibody (S25-35) [NBP2-12902] - human hippocampal sections using this antibody.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
TBK1 Antibody
(108A429)
NB100-56705
Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Immunohistochemistry: TBK1 Antibody (108A429) - Azide and BSA Free [NBP2-33243] - Staining on human testis (Formalin-Fixed Paraffin-Embedded (FFPE)) Image from the Azide and BSA Free version of this antibody.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
HMGA2 Antibody
[Unconjugated]
AF3184
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, MDA‑MD‑231 human breast cancer cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and P19 mouse embryonal carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse HMGA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3184) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HMGA2 at approximately 21 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for HMGA2 at approximately 30 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse HMGA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3184) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(7 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC
GAS41 Antibody
NBP2-16609
Western Blot: GAS41 Antibody [NBP2-16609] - Sample (30 ug of whole cell lysate) A: A549 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: GAS41 Antibody [NBP2-16609] - Immunofluorescence analysis of paraformaldehyde-fixed A549, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF
Siglec-1/CD169
Antibody (HSn 7D2)
NB600-534
Immunohistochemistry-Frozen: Siglec-1/CD169 Antibody (HSn 7D2) [NB600-534] - Adult mouse small intestine. NB600-534 Siglec-1 was used at 1:500 and labeled with Alexa Fluor 568 conjugated secondary antibody (Red). DAPI shown as blue. Image from verified customer review.
Flow Cytometry: Siglec-1/CD169 Antibody (HSn 7D2) [NB600-534] - Human CD14+ PBMC differentiated to M1 macrophages with rhGM-CSF were stained with Mouse Anti-Siglec-1/CD169 Monoclonal Antibody (NB600-534, filled histogram), or Mouse IgG1 isotype control (MAB002, open histogram) followed by APC-conjugated Anti-Mouse IgG Secondary Antibody (F0101B).
Immunohistochemistry-Paraffin: Siglec-1/CD169 Antibody (HSn 7D2) [NB600-534] - Staining of Sialoadhesin in human spleen using DAB with hematoxylin counterstain.
(1 Review)
(17 Publications)
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Oncostatin M/OSM
[Unconjugated]
8475-OM/CF
Oncostatin M/OSM [Unconjugated]
(1 Publication)
Species: Hu

Publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP) (0)

There are no publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP) (0)

There are no reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Glucosamine (N-acetyl)-6-Sulfatase/GNS Products

Bioinformatics Tool for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP)

Discover related pathways, diseases and genes to Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP)

Discover more about diseases related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP).
 

Pathways for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP)

View related products by pathway.

PTMs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP)

Learn more about PTMs related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein (NBP2-38583PEP).

Blogs on Glucosamine (N-acetyl)-6-Sulfatase/GNS

There are no specific blogs for Glucosamine (N-acetyl)-6-Sulfatase/GNS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
TBK1 Antibody (108A429)
NB100-56705

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GNS