GLS2 Antibody


Western Blot: GLS2 Antibody [NBP1-54773] - Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: GLS2 Antibody [NBP1-54773] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

GLS2 Antibody Summary

Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Protein A purified


Application Notes
This is a rabbit polyclonal antibody against GLS2 and was validated on Western Blot and immunohistochemistry-P

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
36 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLS2 Antibody

  • EC
  • GAbreast cell glutaminase
  • GLSglutaminase GA
  • glutaminase 2 (liver, mitochondrial)
  • glutaminase I
  • glutaminase liver isoform, mitochondrial
  • hLGA
  • LGA
  • L-glutaminase
  • L-glutamine amidohydrolase
  • MGC71567
  • phosphate-activated glutaminase
  • phosphate-dependent glutaminase
  • truncated glutaminase 2


GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: Func, PAGE
Species: Hu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GLS2 Antibody (NBP1-54773) (0)

There are no publications for GLS2 Antibody (NBP1-54773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLS2 Antibody (NBP1-54773) (0)

There are no reviews for GLS2 Antibody (NBP1-54773). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLS2 Antibody (NBP1-54773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GLS2 Antibody Products

Related Products by Gene

Bioinformatics Tool for GLS2 Antibody (NBP1-54773)

Discover related pathways, diseases and genes to GLS2 Antibody (NBP1-54773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLS2 Antibody (NBP1-54773)

Discover more about diseases related to GLS2 Antibody (NBP1-54773).

Pathways for GLS2 Antibody (NBP1-54773)

View related products by pathway.

PTMs for GLS2 Antibody (NBP1-54773)

Learn more about PTMs related to GLS2 Antibody (NBP1-54773).

Blogs on GLS2

There are no specific blogs for GLS2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol GLS2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-54773 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought