GLS2 Antibody

Images

 
Western Blot: GLS2 Antibody [NBP1-54773] - Sample Tissue: Human NCI-H226 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: GLS2 Antibody [NBP1-54773] - Human kidney
Western Blot: GLS2 Antibody [NBP1-54773] - Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

GLS2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GLS2 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLS2 Antibody

  • EC 3.5.1.2
  • GAbreast cell glutaminase
  • GLSglutaminase GA
  • glutaminase 2 (liver, mitochondrial)
  • glutaminase I
  • glutaminase liver isoform, mitochondrial
  • hLGA
  • LGA
  • L-glutaminase
  • L-glutamine amidohydrolase
  • MGC71567
  • phosphate-activated glutaminase
  • phosphate-dependent glutaminase
  • truncated glutaminase 2

Background

GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-35006
Species: Hu
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GLS2 Antibody (NBP1-54773) (0)

There are no publications for GLS2 Antibody (NBP1-54773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLS2 Antibody (NBP1-54773) (0)

There are no reviews for GLS2 Antibody (NBP1-54773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLS2 Antibody (NBP1-54773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLS2 Products

Bioinformatics Tool for GLS2 Antibody (NBP1-54773)

Discover related pathways, diseases and genes to GLS2 Antibody (NBP1-54773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLS2 Antibody (NBP1-54773)

Discover more about diseases related to GLS2 Antibody (NBP1-54773).
 

Pathways for GLS2 Antibody (NBP1-54773)

View related products by pathway.

PTMs for GLS2 Antibody (NBP1-54773)

Learn more about PTMs related to GLS2 Antibody (NBP1-54773).

Blogs on GLS2

There are no specific blogs for GLS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS2
Entrez
Uniprot