GLRB Antibody

Images

 
Immunohistochemistry: GLRB Antibody [NBP2-30683] - Staining of human cerebral cortex shows cytoplasmic positivity in a subset of glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLRB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLRB Protein (NBP2-30683PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLRB Antibody

  • beta subunit
  • Glycine receptor 58 kDa subunit
  • glycine receptor, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-113
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
MAB7848
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GLRB Antibody (NBP2-30683) (0)

There are no publications for GLRB Antibody (NBP2-30683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLRB Antibody (NBP2-30683) (0)

There are no reviews for GLRB Antibody (NBP2-30683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GLRB Antibody (NBP2-30683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLRB Products

Bioinformatics Tool for GLRB Antibody (NBP2-30683)

Discover related pathways, diseases and genes to GLRB Antibody (NBP2-30683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLRB Antibody (NBP2-30683)

Discover more about diseases related to GLRB Antibody (NBP2-30683).
 

Pathways for GLRB Antibody (NBP2-30683)

View related products by pathway.

PTMs for GLRB Antibody (NBP2-30683)

Learn more about PTMs related to GLRB Antibody (NBP2-30683).

Blogs on GLRB

There are no specific blogs for GLRB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLRB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRB
Uniprot