Neurobeachin Antibody

Images

 
Immunohistochemistry: Neurobeachin Antibody [NBP1-90004] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neurobeachin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETTRTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFGHSFYKETPAAFPDTIKEKETPTPGEDIQVESSIPHTDSGIGEEQVASILNGAELETSTGPDAMSEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NBEA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neurobeachin Protein (NBP1-90004PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurobeachin Antibody

  • BCL8Blysosomal trafficking regulator 2
  • EC 1.14.14.5
  • EC 6.1.1.11
  • FLJ10197
  • KIAA1544
  • Lysosomal-trafficking regulator 2
  • LYST2
  • neurobeachin
  • Protein BCL8B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90764
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP2-19961
Species: Hu, Mu
Applications: WB
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-90175
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for Neurobeachin Antibody (NBP1-90004) (0)

There are no publications for Neurobeachin Antibody (NBP1-90004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurobeachin Antibody (NBP1-90004) (0)

There are no reviews for Neurobeachin Antibody (NBP1-90004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurobeachin Antibody (NBP1-90004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurobeachin Products

Bioinformatics Tool for Neurobeachin Antibody (NBP1-90004)

Discover related pathways, diseases and genes to Neurobeachin Antibody (NBP1-90004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurobeachin Antibody (NBP1-90004)

Discover more about diseases related to Neurobeachin Antibody (NBP1-90004).
 

Pathways for Neurobeachin Antibody (NBP1-90004)

View related products by pathway.

PTMs for Neurobeachin Antibody (NBP1-90004)

Learn more about PTMs related to Neurobeachin Antibody (NBP1-90004).

Blogs on Neurobeachin

There are no specific blogs for Neurobeachin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurobeachin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NBEA