Glycine Receptor Alpha 1 Antibody

Images

 
Immunohistochemistry: Glycine Receptor Alpha 1 Antibody [NBP1-86988] - Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycine Receptor Alpha 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glycine Receptor Alpha 1 Protein (NBP1-86988PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycine Receptor Alpha 1 Antibody

  • GLRA 1
  • Glycine receptor 48 kDa subunit
  • Glycine receptor strychnine-binding subunit
  • glycine receptor subunit alpha-1
  • glycine receptor, alpha 1 (startle disease/hyperekplexia)
  • glycine receptor, alpha 1
  • MGC138878
  • MGC138879
  • STHE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-45808
Species: Hu
Applications: IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
MAB7848
Species: Hu
Applications: WB, IHC
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-191
Species: Hu, Mu, Rt
Applications: WB
NBP1-86988
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)

There are no publications for Glycine Receptor Alpha 1 Antibody (NBP1-86988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)

There are no reviews for Glycine Receptor Alpha 1 Antibody (NBP1-86988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycine Receptor Alpha 1 Products

Bioinformatics Tool for Glycine Receptor Alpha 1 Antibody (NBP1-86988)

Discover related pathways, diseases and genes to Glycine Receptor Alpha 1 Antibody (NBP1-86988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycine Receptor Alpha 1 Antibody (NBP1-86988)

Discover more about diseases related to Glycine Receptor Alpha 1 Antibody (NBP1-86988).
 

Pathways for Glycine Receptor Alpha 1 Antibody (NBP1-86988)

View related products by pathway.

Research Areas for Glycine Receptor Alpha 1 Antibody (NBP1-86988)

Find related products by research area.

Blogs on Glycine Receptor Alpha 1

There are no specific blogs for Glycine Receptor Alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycine Receptor Alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRA1