Glycine Receptor Alpha 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK |
| Predicted Species |
Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GLRA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Glycine Receptor Alpha 1 Antibody - BSA Free
Background
Glycine is an important inhibitory neurotransmitter in the mammalian central nervous system, especially in the brainstem and spinal cord. It acts by binding to anion-conducting glycine receptors that belong to a superfamily of ligand-gated ion channels. Glycine receptors were first purified as strychnine binding sites in membrane fractions of adult spinal cord from rats (1). These strychnine-sensitive binding sites are different from the strychnine-insensitive binding sites found in the N-methyl-D-aspartate (NMDA) subtype of glutamate receptors. Adult glycine receptors are heterodimers composed of two subunits of 48 kDa and 58 kDa, denoted as a1 and b subunits. Fetal glycine receptors are homomers composed of a2 subunits.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, MiAr, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Publications for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)
There are no publications for Glycine Receptor Alpha 1 Antibody (NBP1-86988).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)
There are no reviews for Glycine Receptor Alpha 1 Antibody (NBP1-86988).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Glycine Receptor Alpha 1 Antibody (NBP1-86988) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glycine Receptor Alpha 1 Products
Research Areas for Glycine Receptor Alpha 1 Antibody (NBP1-86988)
Find related products by research area.
|
Blogs on Glycine Receptor Alpha 1