GLP/EHMT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GLP/EHMT1 Antibody [NBP3-17670] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLP/EHMT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV
• Predicted Species: Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHMT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GLP/EHMT1 Antibody - BSA Free

• DEL9q34
• EC 2.1.1.-
• EC 2.1.1.43
• EHMT1
• euchromatic histone-lysine N-methyltransferase 1H3-K9-HMTase 5
• Eu-HMTase1
• Eu-HMTase1DEL9q34
• EUHMTASE1FP13812
• FLJ12879
• G9a-like protein 1
• GLP
• GLP1
• H3 lysine-9 specific 5
• KIAA1876euchromatic histone methyltransferase 1
• KMT1D
• KMT1DDKFZp667M072
• Lysine N-methyltransferase 1D

Background

Euchromatic histone-lysine N-methyltransferase 1 (EHMT1) is a histone methyltransferase that catalyzes the methylation of lysine-9 of histone H3 (H3-K9). H3-K9 histone methylation is restricted to euchromatin and functions to epigenetically silence gene transcription. Loss of function mutations in EHMT1 cause the 9q34 subtelomeric deletion syndrome, a syndrome characterized by severe mental retardation, hypotonia, brachy(micro)cephaly, heart defects, and distinct facial anomalies. Alternate names for EHMT1 include histone H3-K9 methyltransferase 5, H3-K9-HMTase5, eu-HMTase, G9a-like protein 1, GLP1, lysine N-methyltransferase 1D, EUHMTASE1, KMT1D, and KIAA1876.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EHMT1