GLP/EHMT1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GLP/EHMT1 Antibody - BSA Free (NBP3-17670) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV |
| Predicted Species |
Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EHMT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GLP/EHMT1 Antibody - BSA Free
Background
Euchromatic histone-lysine N-methyltransferase 1 (EHMT1) is a histone methyltransferase that catalyzes the methylation of lysine-9 of histone H3 (H3-K9). H3-K9 histone methylation is restricted to euchromatin and functions to epigenetically silence gene transcription. Loss of function mutations in EHMT1 cause the 9q34 subtelomeric deletion syndrome, a syndrome characterized by severe mental retardation, hypotonia, brachy(micro)cephaly, heart defects, and distinct facial anomalies. Alternate names for EHMT1 include histone H3-K9 methyltransferase 5, H3-K9-HMTase5, eu-HMTase, G9a-like protein 1, GLP1, lysine N-methyltransferase 1D, EUHMTASE1, KMT1D, and KIAA1876.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: IHC
Publications for GLP/EHMT1 Antibody (NBP3-17670) (0)
There are no publications for GLP/EHMT1 Antibody (NBP3-17670).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLP/EHMT1 Antibody (NBP3-17670) (0)
There are no reviews for GLP/EHMT1 Antibody (NBP3-17670).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GLP/EHMT1 Antibody (NBP3-17670) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLP/EHMT1 Products
Research Areas for GLP/EHMT1 Antibody (NBP3-17670)
Find related products by research area.
|
Blogs on GLP/EHMT1