GLI-1 Recombinant Protein Antigen

Images

 
There are currently no images for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLI-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLI-1.

Source: E.coli

Amino Acid Sequence: PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68877. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLI-1 Recombinant Protein Antigen

  • GLI family zinc finger 1
  • GLI1
  • GLI-1
  • glioma-associated oncogene family zinc finger 1
  • glioma-associated oncogene homolog 1 (zinc finger protein)
  • Glioma-associated oncogene
  • GLIzinc finger protein GLI1
  • Oncogene GLI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, ICC
1705-HH/CF
Species: Hu, Mu
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-68877PEP
Species: Hu
Applications: AC

Publications for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP) (0)

There are no publications for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP) (0)

There are no reviews for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP)

Discover related pathways, diseases and genes to GLI-1 Recombinant Protein Antigen (NBP2-68877PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP)

Discover more about diseases related to GLI-1 Recombinant Protein Antigen (NBP2-68877PEP).
 

Pathways for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP)

View related products by pathway.

PTMs for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP)

Learn more about PTMs related to GLI-1 Recombinant Protein Antigen (NBP2-68877PEP).
 

Research Areas for GLI-1 Recombinant Protein Antigen (NBP2-68877PEP)

Find related products by research area.

Blogs on GLI-1

There are no specific blogs for GLI-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLI-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI1